2024-05-18 21:41:34, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_024857773 300 bp mRNA linear PLN 26-APR-2018 DEFINITION [Candida] pseudohaemulonii 60S ribosomal protein L36 (C7M61_002398), partial mRNA. ACCESSION XM_024857773 VERSION XM_024857773.1 DBLINK BioProject: PRJNA453594 BioSample: SAMN08714088 KEYWORDS RefSeq. SOURCE [Candida] pseudohaemulonii ORGANISM [Candida] pseudohaemulonii Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Metschnikowiaceae; Metschnikowiaceae incertae sedis; Candida/Metschnikowiaceae. REFERENCE 1 (bases 1 to 300) AUTHORS Munoz,J.F., Gade,L.G., Chow,N.A., Litvintseva,A.P., Loparev,V.N. and Cuomo,C.A. TITLE Candida pseudohaemulonii genome assembly and annotation JOURNAL Unpublished REFERENCE 2 (bases 1 to 300) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (26-APR-2018) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 300) AUTHORS Munoz,J.F., Gade,L.G., Chow,N.A., Litvintseva,A.P., Loparev,V.N. and Cuomo,C.A. TITLE Direct Submission JOURNAL Submitted (20-MAR-2018) Genome Sequencing and Analysis Program, Broad Institute of MIT and Harvard, 415 Main Street, Cambridge, MA 02142, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_020194438). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..300 /organism="[Candida] pseudohaemulonii" /mol_type="mRNA" /strain="B12108" /host="Homo sapiens" /db_xref="taxon:418784" /chromosome="Unknown" /country="Venezuela" /collected_by="CDC" gene <1..>300 /locus_tag="C7M61_002398" /db_xref="GeneID:36565787" CDS 1..300 /locus_tag="C7M61_002398" /codon_start=1 /product="60S ribosomal protein L36" /protein_id="XP_024714272.1" /db_xref="GeneID:36565787" /translation="
MARSGIAVGLNKGHKVNAKEVAPRISQRKGALSQRTKFVRSIVSEVSGLAPYERRLIELIRNAGEKRAKKLAKKRLGTHKRALRKVEEMNQIITESRRH"
misc_feature 10..294 /locus_tag="C7M61_002398" /note="Ribosomal protein L36e; Region: Ribosomal_L36e; pfam01158" /db_xref="CDD:426088" ORIGIN
atggctagatctggtattgctgtcggtttgaacaagggccacaaggtcaacgctaaggaggttgctccaagaatctcccagagaaagggtgctctttcccagagaaccaagttcgtcagaagcattgtctctgaggtctccggtttggctccatacgagagaagattgattgaattgatcagaaacgccggtgagaagagagccaagaagttggccaagaagagattgggtactcacaagagagctctcagaaaggtcgaggagatgaaccagatcatcactgagtccagaagacactaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]