LOCUS       XM_024529008            1702 bp    mRNA    linear   PLN 04-APR-2018
DEFINITION  PREDICTED: Physcomitrella patens uncharacterized LOC112286762
            (LOC112286762), mRNA.
ACCESSION   XM_024529008
VERSION     XM_024529008.1
DBLINK      BioProject: PRJNA28131
KEYWORDS    RefSeq.
SOURCE      Physcomitrium patens
  ORGANISM  Physcomitrium patens
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Bryophyta;
            Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae;
            Physcomitrium.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_037261.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Physcomitrella patens Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1702
                     /organism="Physcomitrium patens"
                     /mol_type="mRNA"
                     /db_xref="taxon:3218"
                     /chromosome="9"
                     /ecotype="Gransden 2004"
     gene            1..1702
                     /gene="LOC112286762"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 6 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:112286762"
     CDS             232..543
                     /gene="LOC112286762"
                     /codon_start=1
                     /product="uncharacterized protein LOC112286762"
                     /protein_id="XP_024384776.1"
                     /db_xref="GeneID:112286762"
                     /translation="

MGDLNSIFDCNRFPPISREDLPSDKVNWRFRLQKFIDMGGLQRDLDMVSARWPDEYLSEPKVDNDRDDISVIVITGYPPRHNYDVQRVLNLVYKHDPTATLVI"

ORIGIN      

tgctcattcgacgacaggaatcacagtattagccatccaatacccgctgccacttgagcctcgagcgagaaacgattgagtgcttgacaggctcctgtgtgatcggttctgttgagaagctgttaagcgcagcaggatcctgcaggctagtcaagcatcactgccctcgatcgttgcttgctgcagttctccaaggccttcagtggttcgtgcgactctcaacttcctgacatgggcgatctaaatagtatttttgactgcaatcgttttcctcccatcagccgcgaagaccttccgagtgacaaggttaattggagattcaggctccagaagttcatcgacatgggcggcctccaaagagatctggacatggtatcagcccgctggccagatgagtacttgtcagagcctaaggtggataatgatcgtgatgacatcagcgtcatagttattacaggatacccgcctcgtcacaattacgatgtacagcgcgttctgaacttagtctacaagcatgacccaacagcaacacttgtgatttgagtaatggtttgccattttgaatgctgttgcgagacatgacaaaagaacaagttttatgtagctattgatactgtgctaatttaaaaacataacaggactgaatatatactgtgtcgcgtatataccacatgttctttatatgctaaatgttattggataaatacactcattcgacatactacatatggatgtaaatcataaccagaagtacataggttgatgtaaatcataaccagaagtacataggttgatgtacaatgtagagcggctaatcttttacagtgagtgatcccgttagcgtagagattagcagcttgttctgccgcatcttgaagacggtattgtatagtggtccgagtgcaattgcacggttgaaataatagtcacattctgtgttgctattgtgtgtttgttgtgtgttaaatttcaacaaatatcctccataggttgtaatagtttccaaccaagcatttgcgtctcctacttcaatgagttgtaaatgagacatgttgctcttttcaagggaattatgcacccttattattcttaatcactcagggtagcggggttggagggattgtgggaaaactcgtcgttatttctcagtacctcccatgatgcagactttgttttcgcccacaacgttgatacgaaggaaggcagacatctccactattgaagaaggacgatgggtcacgacttgtctcggatctgatctcggtggacttccatgtggcgatgggtttcttcgtgtctgcacccggtccgtgtctgccaaggtgttctgcagaccttcaattgcatggctccgcggactctcagggacactaaaacggcagacacgcatgttcgttcctaaaggataaacatagaatctctgcaggattacccttttcctttcaccctcttgtaatgaattcatgttgggctttgtgggctcattcctccacgagtgatttgattccctttttccttgtgttttcctgaaaaatgcgaaagtaacatggatcaccgagatgcaagaattgtttacgtgttattacttcaattcccgcgtaacaatatatggattatatattcaaggcttgctaaccgtttatcatctagtgcttggtctggacccctaaccattgaagaaggttggctgcggcgaaggatc

//