LOCUS       XM_024151048             357 bp    mRNA    linear   PLN 26-FEB-2018
DEFINITION  PREDICTED: Eutrema salsugineum root meristem growth factor 1
            (LOC18013236), mRNA.
ACCESSION   XM_024151048
VERSION     XM_024151048.1
DBLINK      BioProject: PRJNA231865
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Eutrema salsugineum
  ORGANISM  Eutrema salsugineum
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Eutremeae; Eutrema.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_006256547.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Eutrema salsugineum Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 2% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..357
                     /organism="Eutrema salsugineum"
                     /mol_type="mRNA"
                     /db_xref="taxon:72664"
                     /chromosome="Unknown"
     gene            1..357
                     /gene="LOC18013236"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 4 Proteins"
                     /db_xref="GeneID:18013236"
     CDS             1..357
                     /gene="LOC18013236"
                     /codon_start=1
                     /product="root meristem growth factor 1"
                     /protein_id="XP_024006816.1"
                     /db_xref="GeneID:18013236"
                     /translation="

MVAMNMRVFCYLLIFFILQLYAKVSNANLNRQAPLTANNGGLGASTSTPIDNKAIDNVSENRKTLKHGTVNVEGNEKNGLEIESKETVRKEKNMTRLTKTVSLTADYSAPGHHPPRHN"

ORIGIN      

atggtggccatgaatatgagggttttttgctatcttctaatatttttcatcttgcaattatatgctaaagtctccaacgcaaacttaaatagacaagctccactgacggcaaataatggtggtcttggagcaagcactagtactccaattgacaacaaggctattgataatgtaagcgaaaaccgaaagacgttgaagcatggaactgtgaacgttgagggaaatgaaaagaatggtttagagatagagagcaaagaaacagtgaggaaagaaaagaacatgacgagactcaccaaaacggtgagtttaacggctgattatagtgcccctggtcatcatcctcctaggcataattaa

//