LOCUS       XM_024031335             732 bp    mRNA    linear   PLN 15-FEB-2018
DEFINITION  PREDICTED: Quercus suber uncharacterized membrane protein YuiD-like
            (LOC111999214), mRNA.
ACCESSION   XM_024031335
VERSION     XM_024031335.1
DBLINK      BioProject: PRJNA433227
KEYWORDS    RefSeq.
SOURCE      Quercus suber
  ORGANISM  Quercus suber
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; fabids; Fagales; Fagaceae; Quercus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_019822142.1) annotated using gene prediction method: Gnomon,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Quercus suber Annotation Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..732
                     /organism="Quercus suber"
                     /mol_type="mRNA"
                     /isolate="HL8"
                     /db_xref="taxon:58331"
                     /chromosome="Unknown"
                     /tissue_type="leaves"
                     /country="Portugal:Montargil"
     gene            1..732
                     /gene="LOC111999214"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 mRNAs, 1 EST, 2 Proteins, and
                     100% coverage of the annotated genomic feature by RNAseq
                     alignments, including 9 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:111999214"
     CDS             430..630
                     /gene="LOC111999214"
                     /codon_start=1
                     /product="uncharacterized protein LOC111999214"
                     /protein_id="XP_023887103.1"
                     /db_xref="GeneID:111999214"
                     /translation="

MYDATGVRLHAGRQAELLNQIVCELPSEHPLSNIRPLRDSLGHTPLQVVAGAVLGCIIAYLMGNAK"

     misc_feature    <430..603
                     /gene="LOC111999214"
                     /note="Divergent PAP2 family; Region: DUF212; cl23953"
                     /db_xref="CDD:451626"
ORIGIN      

cctgattattcgcaattgttactgatttttgctctcactaagattagcaagttcagtattgttgctatgaatttcacttggactgcttctatttattcaataatggaggatattagggatctgggtttgatcagttttaaccataattgcaccttgcttctaagccgccattgccattgttgtacaagtcctttaaatttgtaattaaatagtgctttgagtttgaggttacataaatcagtccaaagtgtcaaacttctgtggaatttcaatactccatgtcccctaattccttgtttcatgatatcatgaatcttctcatctttttgttgtatctcatcattttgagaataggtttagtttactcaggaatagttactataaattcaagatggacatgattgattgttttaatatattttgcaggtgatgtatgatgccacgggggtcagacttcatgctggtcgtcaagcggaattgctgaatcaaattgtgtgtgagcttccttcagaacatcctttatccaacataagacctcttcgagattcactagggcatactccacttcaggttgttgctggtgctgtgttgggatgcataatagcatatctgatgggaaatgcgaaataggatatcaaatgaccaatattatttcccttgtcacgaatttggatacatgtaaactgcatacttgtaatctggttactcttatagtgaaaactactttgttca

//