GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-19 06:06:52, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_023884671            1398 bp    mRNA    linear   PLN 22-DEC-2022
DEFINITION  PREDICTED: Lactuca sativa uncharacterized LOC111888508
            (LOC111888508), mRNA.
ACCESSION   XM_023884671
VERSION     XM_023884671.2
DBLINK      BioProject: PRJNA432228
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Lactuca sativa (garden lettuce)
  ORGANISM  Lactuca sativa
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; asterids; campanulids; Asterales; Asteraceae;
            Cichorioideae; Cichorieae; Lactucinae; Lactuca.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_056627) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 22, 2022 this sequence version replaced XM_023884671.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_002870075.4-RS_2022_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1398
                     /organism="Lactuca sativa"
                     /mol_type="mRNA"
                     /cultivar="Salinas"
                     /db_xref="taxon:4236"
                     /chromosome="5"
     gene            1..1398
                     /gene="LOC111888508"
                     /note="uncharacterized LOC111888508; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:111888508"
     CDS             1..1398
                     /gene="LOC111888508"
                     /codon_start=1
                     /product="uncharacterized protein LOC111888508"
                     /protein_id="XP_023740439.2"
                     /db_xref="GeneID:111888508"
                     /translation="
MALRHLIIMLPLLFASCSGGADARKGYLCPGGGNGGKGCPCPGGCPCPAAADGGKECPCPGGGDGGKGCHCPDGCPCPGAADSEKGCPCSGGADGGKGCHCPDGCSCPAAVDGGKECRCPGGGDGGKGCHCPDGCSCPAATDGGKECICPGGGDGGKGCHCPDGCPCPAATDSGKECPCPGGADGGKGCHCPDGCSCPAATDGGKECICPGGGDGGKGCHCPDGCSCPAATDGGKECPCSGGADGGKGCPCAGGADGGIGCPCAGGADGGKGCPCAGDAGGGKGCPCAGGADGGKGCPCAGDAAGGKGCPCAGGADNVKGCPCAGGPDGAKGCPCAGGADGGKGCPCAGGADGGKGCPCAGGAEGGKGCPCAGGAEGRKGCPCAGGADGGKGCPCAGGVCCGKGCPCAGGAEGGKGCPCADGSEGGKGCPCAGGADNGKGCPCAGGADGGKDSKQDVTEKGNIKT"
ORIGIN      
atggcactcagacacctaatcatcatgctccctttgttatttgcatcttgttcgggtggtgccgatgccaggaaaggttacctttgtccgggtggtggcaacggtgggaaagggtgcccttgtccgggtgggtgtccttgtccagctgctgccgatggtgggaaagaatgcccttgtccgggtggtggtgacggcgggaaagggtgccattgtccggatgggtgtccttgtccgggtgctgccgacagtgagaaaggctgcccttgttcgggtggtgctgacggtgggaaagggtgccattgtccggatgggtgttcttgtccggctgctgtcgacggtggtaaagaatgtcgttgtccgggtggtggcgacggtgggaaagggtgccattgtccggatgggtgttcttgtccggctgctaccgatggagggaaagaatgcatttgtccgggtggtggtgacggagggaaagggtgccattgtccagatgggtgtccttgtccggctgctacagacagtggtaaagagtgcccttgtccgggtggtgccgacggtgggaaagggtgccattgtccggatgggtgttcttgtccggctgctaccgatggtgggaaagaatgcatttgtccgggtggtggtgacggagggaaagggtgccattgtccggatgggtgttcttgtccggctgctacagacggtggtaaagagtgcccttgttcgggtggtgccgacggtgggaaaggttgcccttgtgcgggtggtgccgacggggggatagggtgcccttgtgcgggaggtgccgacggcgggaaaggatgcccttgtgcgggtgatgccggcggtggaaaagggtgcccttgtgcgggtggtgccgacggagggaaagggtgcccttgtgcgggtgatgccgctggcgggaaagggtgcccttgtgcgggtggtgccgacaacgtgaaagggtgcccttgtgcgggaggtcccgacggtgcgaaagggtgtccttgtgcgggtggtgccgacggcggaaaaggatgcccttgtgcgggtggtgccgacggcgggaaaggatgcccttgtgcgggtggtgctgaaggcgggaaaggctgcccttgtgctggtggtgctgaaggcaggaaaggttgcccttgtgcgggtggtgccgatggcgggaaaggttgcccttgtgcgggtggtgtctgttgcgggaaaggttgcccttgtgcgggtggtgccgaaggagggaaaggatgcccttgtgcggatggttccgaaggcgggaaaggttgcccttgtgcaggtggtgccgacaacgggaaaggctgcccttgtgcgggtggtgccgacggcgggaaagacagcaaacaggatgttacagaaaaagggaacatcaaaacttga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]