LOCUS       XM_023785205             311 bp    mRNA    linear   PLN 02-FEB-2018
DEFINITION  PREDICTED: Capsella rubella protein CLAVATA 3 (LOC111831232), mRNA.
ACCESSION   XM_023785205
VERSION     XM_023785205.1
DBLINK      BioProject: PRJNA230563
KEYWORDS    RefSeq.
SOURCE      Capsella rubella
  ORGANISM  Capsella rubella
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Capsella.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_006238920.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Capsella rubella Annotation Release
                                           100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..311
                     /organism="Capsella rubella"
                     /mol_type="mRNA"
                     /cultivar="Monte Gargano"
                     /bio_material="ABRC:CS22697"
                     /db_xref="taxon:81985"
                     /chromosome="Unknown"
     gene            1..311
                     /gene="LOC111831232"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 Proteins, and 66% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 1 sample with support for all annotated introns"
                     /db_xref="GeneID:111831232"
     CDS             21..311
                     /gene="LOC111831232"
                     /codon_start=1
                     /product="protein CLAVATA 3"
                     /protein_id="XP_023640973.1"
                     /db_xref="GeneID:111831232"
                     /translation="

MDSSRSLVLLLLFCLLFLHDASDLTQAHGHVTSLPTRKMMMMNKGSETVGANEEKEEKKIKGLGLNEELRTVPSGPDPLHHHVNPPRQPRNHSLLP"

ORIGIN      

gttcagtttctctctaagtaatggattcatcaagaagtcttgtgctactactactcttctgcctcttgttcctccacgatgcttctgatctcacgcaagctcatggccacgttacttcacttcccacccgcaagatgatgatgatgaacaagggtagtgaaactgtaggagcaaatgaagagaaagaagagaagaagatcaaaggtttagggctaaatgaagagctaaggaccgttccttcaggacctgaccctttgcaccatcatgtgaacccaccaagacagccaagaaaccactctcttctcccttga

//