LOCUS       XM_023765091             976 bp    mRNA    linear   MAM 26-JAN-2018
DEFINITION  PREDICTED: Myotis lucifugus copper chaperone for superoxide
            dismutase (CCS), transcript variant X2, mRNA.
ACCESSION   XM_023765091
VERSION     XM_023765091.1
DBLINK      BioProject: PRJNA208947
KEYWORDS    RefSeq.
SOURCE      Myotis lucifugus (little brown bat)
  ORGANISM  Myotis lucifugus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Chiroptera; Microchiroptera;
            Vespertilionidae; Myotis.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_005871421.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Myotis lucifugus Annotation Release
                                           102
            Annotation Version          :: 102
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..976
                     /organism="Myotis lucifugus"
                     /mol_type="mRNA"
                     /db_xref="taxon:59463"
                     /chromosome="Unknown"
                     /sex="female"
                     /country="USA: Framingham, MA"
     gene            1..976
                     /gene="CCS"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 6 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:102440019"
     CDS             114..809
                     /gene="CCS"
                     /codon_start=1
                     /product="copper chaperone for superoxide dismutase
                     isoform X2"
                     /protein_id="XP_023620859.1"
                     /db_xref="GeneID:102440019"
                     /translation="

MASDSGDRETACTLEFAVQMTCQSCVDAVRRSLQGVAENLGAAVAILGGPGPVQGVVRFLQLTPERCLIEGTIDGLEPGPHGLHVHQFGDLTRNCNSCGDHFNPDGTSHGGPRDSDRHRGDLGNVHADANGQAIFRIEDEQLKVWDVIGRSLVIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICTCDGLTIWEERGRPIAGKGRKEPSQPSQPPAHL"

     misc_feature    156..>221
                     /gene="CCS"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    order(171..179,186..188)
                     /gene="CCS"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     misc_feature    240..656
                     /gene="CCS"
                     /note="Copper/zinc superoxide dismutase (SOD). superoxide
                     dismutases catalyse the conversion of superoxide radicals
                     to molecular oxygen. Three evolutionarily distinct
                     families of SODs are known, of which the
                     copper/zinc-binding family is one. Defects in the...;
                     Region: Cu-Zn_Superoxide_Dismutase; cd00305"
                     /db_xref="CDD:238186"
     misc_feature    order(243..245,249..251,279..281,285..287,375..383,
                     555..560)
                     /gene="CCS"
                     /note="E-class dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238186"
     misc_feature    order(315..317,489..491)
                     /gene="CCS"
                     /note="P-class dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238186"
     misc_feature    order(363..365,369..371,414..416,465..467,474..476,
                     576..578)
                     /gene="CCS"
                     /note="active site"
                     /db_xref="CDD:238186"
     misc_feature    order(363..365,369..371,414..416,576..578)
                     /gene="CCS"
                     /note="Cu2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238186"
     misc_feature    order(414..416,438..440,465..467,474..476)
                     /gene="CCS"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238186"
ORIGIN      

caggaggcgggacaaagcctggcttccgaggctccgcctcctcgtgatgctgcttggatttccgctgtaggactcgagctgttctggtcctcctgccagtgactgggtccgagatggcgtcggactcgggggaccgggagaccgcctgcacgttggagttcgccgtgcagatgacctgtcagagctgtgtggacgcagtgcgcaggtccctgcaaggggtggcagagaatctgggggcagcagtggccattctaggaggccctggccctgtgcagggggtggtgcgcttcctacagctgacccctgagcgctgcctcattgagggaaccattgatggcctggagcctgggccacacggactccatgtccatcagttcggggacctcacaaggaactgcaacagctgtggggaccactttaaccctgatggaacatctcatgggggccctcgggactctgaccggcaccggggagacctggggaacgtccacgctgatgctaatggccaagccatcttcaggatagaggatgagcagctgaaggtatgggatgtgattggccgaagcctggtcattgatgagggagaagacgacctgggccggggcggccatcccttatccaagatcacggggaactcaggagagaggttggcctgtggcatcattgcacgctccgctggccttttccagaaccccaagcagatctgcacctgcgacggcctcaccatctgggaggagcgaggccggcccattgctggcaagggacgaaaggaaccgtcgcagccatcccagccccctgcccacctctgagcaaggcctccgcctcagtctcaggtccaccatcctcccagctgatgccatcctcttccaggggatgggggagccctgcttgcctagtccgagaacaagggtacggggtgtgcagggattgctgtgacgctcccttggcaaagtaaagtttttctattcatatggaa

//