LOCUS       XM_023418085             435 bp    mRNA    linear   VRT 26-DEC-2017
DEFINITION  PREDICTED: Seriola lalandi dorsalis sarcoplasmic/endoplasmic
            reticulum calcium ATPase 1-like (LOC111663770), partial mRNA.
ACCESSION   XM_023418085
VERSION     XM_023418085.1
DBLINK      BioProject: PRJNA423295
KEYWORDS    RefSeq.
SOURCE      Seriola lalandi dorsalis
  ORGANISM  Seriola lalandi dorsalis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Neoteleostei;
            Acanthomorphata; Carangaria; Carangiformes; Carangidae; Seriola.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_019471828.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Seriola lalandi dorsalis Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..435
                     /organism="Seriola lalandi dorsalis"
                     /mol_type="mRNA"
                     /isolate="HSWRI2012SDOR001"
                     /sub_species="dorsalis"
                     /db_xref="taxon:1841481"
                     /chromosome="Unknown"
                     /tissue_type="heart"
                     /dev_stage="adult"
                     /ecotype="SW California"
     gene            <1..>435
                     /gene="LOC111663770"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 49 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:111663770"
     CDS             <1..>435
                     /gene="LOC111663770"
                     /codon_start=1
                     /product="sarcoplasmic/endoplasmic reticulum calcium
                     ATPase 1-like"
                     /protein_id="XP_023273853.1"
                     /db_xref="GeneID:111663770"
                     /translation="

IKLFHLHISGDNKGTAIAICRRIGIFSEDEDVSSKAYTGREFDDLPSHEQPEAVVRACCFARVEPSHKSKIVEFLQGHDDITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFI"

     misc_feature    <22..>435
                     /gene="LOC111663770"
                     /note="Haloacid Dehalogenase-like Hydrolases; Region:
                     HAD_like; cl21460"
                     /db_xref="CDD:451251"
ORIGIN      

atcaaacttttccatctccacatttcaggtgacaacaagggaaccgccatcgctatctgccgtcgtattggcatcttctctgaggatgaggacgtttctagcaaggcctacaccggacgtgagtttgacgatctgcccagccatgaacagcccgaagctgtggtcagggcttgctgctttgcccgtgtggagccatcccacaagtccaagattgttgagttcctgcagggtcatgatgacattactgctatgactggtgatggtgtgaatgatgcccctgccctgaagaaggccgagatcggcatcgccatgggctctggcactgccgttgccaagtctgcctctgagatggtcctggctgacgacaacttctcttccattgtggctgctgttgaggagggcagagctatctacaacaacatgaagcagttcatc

//