LOCUS       XM_023358850             324 bp    mRNA    linear   INV 22-DEC-2017
DEFINITION  PREDICTED: Centruroides sculpturatus calcium-transporting ATPase
            type 2C member 1-like (LOC111617534), mRNA.
ACCESSION   XM_023358850
VERSION     XM_023358850.1
DBLINK      BioProject: PRJNA422877
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Centruroides sculpturatus (bark scorpion)
  ORGANISM  Centruroides sculpturatus
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Chelicerata; Arachnida;
            Scorpiones; Buthida; Buthoidea; Buthidae; Centruroides.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_019384303.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Centruroides sculpturatus Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 7% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..324
                     /organism="Centruroides sculpturatus"
                     /mol_type="mRNA"
                     /isolate="CEXI.00-Female"
                     /db_xref="taxon:218467"
                     /chromosome="Unknown"
                     /sex="female"
                     /tissue_type="whole organism"
                     /collection_date="01-Feb-2012"
                     /note="non-domesticated species of scorpion"
     gene            1..324
                     /gene="LOC111617534"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 92% coverage of the annotated
                     genomic feature by RNAseq alignments, including 8 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:111617534"
     CDS             16..324
                     /gene="LOC111617534"
                     /codon_start=1
                     /product="calcium-transporting ATPase type 2C member
                     1-like"
                     /protein_id="XP_023214618.1"
                     /db_xref="GeneID:111617534"
                     /translation="

MKIILKFLGCVNVVCSDKTGTLTKNEMTVTNIITSELYHAEVTGVGYNNDGHILLVDSGNSDLQLNSIRLLLKVGCICNNADIVNGQLRGQPTEGLIYFVTR"

     misc_feature    <25..>306
                     /gene="LOC111617534"
                     /note="Haloacid Dehalogenase-like Hydrolases; Region:
                     HAD_like; cl21460"
                     /db_xref="CDD:451251"
ORIGIN      

atttattttgtagttatgaaaattattcttaaatttttaggctgtgtaaatgtagtttgttctgataaaactggaactttaacaaagaatgaaatgactgtcacaaatattattacatctgagttatatcatgcagaagttacaggtgttggttataataatgatggtcatatacttttggttgactcaggaaatagtgatcttcaacttaattcaattcgcttactattaaaagttggttgcatatgtaacaatgctgatattgttaatggacaactcagaggacaaccgaccgaaggtttaatatattttgtaactagataa

//