2024-05-19 06:53:39, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_023141711 522 bp mRNA linear PLN 29-NOV-2017 DEFINITION PREDICTED: Cucurbita maxima plasma membrane ATPase 4-like (LOC111492385), mRNA. ACCESSION XM_023141711 VERSION XM_023141711.1 DBLINK BioProject: PRJNA418295 KEYWORDS RefSeq. SOURCE Cucurbita maxima (winter squash) ORGANISM Cucurbita maxima Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_019272033.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Cucurbita maxima Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..522 /organism="Cucurbita maxima" /mol_type="mRNA" /cultivar="Rimu" /db_xref="taxon:3661" /chromosome="Unknown" /tissue_type="Young leaves" /dev_stage="Seedlings" /country="China: Beijing" gene 1..522 /gene="LOC111492385" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 8 samples with support for all annotated introns" /db_xref="GeneID:111492385" CDS 245..475 /gene="LOC111492385" /codon_start=1 /product="plasma membrane ATPase 4-like" /protein_id="XP_022997479.1" /db_xref="GeneID:111492385" /translation="
MGGVNAITLEEIKSETVDLERIPIEEVFEQLECTREEHKCEFVKGLKERKHMCAMTGDGVNDAPFFKEGRYRNGCC"
misc_feature <251..>436 /gene="LOC111492385" /note="Haloacid Dehalogenase-like Hydrolases; Region: HAD_like; cl21460" /db_xref="CDD:451251" misc_feature <353..>445 /gene="LOC111492385" /note="plasma-membrane proton-efflux P-type ATPase; Region: ATPase-IIIA_H; TIGR01647" /db_xref="CDD:273731" ORIGIN
gccctagttaactgatatcccccaatcaaaactccgtgaaccctctccacttcttactcttcggaatcgtcctcctcttctttttcttctgttttctttcctcttctccgatggcgatcgtgacgattcttccatgaatctcgtggacttctcgtatttctaaatatactttcctcatcggacttctaattcttcatttcctaactcgagctctcgcgtatgccatcgagcttgcacttcgagaatgggcggagttaatgccatcactcttgaggagattaaaagcgagaccgttgatctggaacgtattccaatagaggaagtgtttgaacagttggaatgtacacgagaagaacacaaatgtgaattcgtgaaagggctgaaggaaaggaagcatatgtgtgcaatgacaggggatggtgttaatgatgcacctttctttaaagaaggcagatatcggaatggctgttgctgatgctactgatgcagccagagtgcttcagatattgttcgtacagaacc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]