GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-19 06:53:39, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_023141711             522 bp    mRNA    linear   PLN 29-NOV-2017
DEFINITION  PREDICTED: Cucurbita maxima plasma membrane ATPase 4-like
            (LOC111492385), mRNA.
ACCESSION   XM_023141711
VERSION     XM_023141711.1
DBLINK      BioProject: PRJNA418295
KEYWORDS    RefSeq.
SOURCE      Cucurbita maxima (winter squash)
  ORGANISM  Cucurbita maxima
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae;
            Cucurbiteae; Cucurbita.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_019272033.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Cucurbita maxima Annotation Release
                                           100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..522
                     /organism="Cucurbita maxima"
                     /mol_type="mRNA"
                     /cultivar="Rimu"
                     /db_xref="taxon:3661"
                     /chromosome="Unknown"
                     /tissue_type="Young leaves"
                     /dev_stage="Seedlings"
                     /country="China: Beijing"
     gene            1..522
                     /gene="LOC111492385"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 8 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:111492385"
     CDS             245..475
                     /gene="LOC111492385"
                     /codon_start=1
                     /product="plasma membrane ATPase 4-like"
                     /protein_id="XP_022997479.1"
                     /db_xref="GeneID:111492385"
                     /translation="
MGGVNAITLEEIKSETVDLERIPIEEVFEQLECTREEHKCEFVKGLKERKHMCAMTGDGVNDAPFFKEGRYRNGCC"
     misc_feature    <251..>436
                     /gene="LOC111492385"
                     /note="Haloacid Dehalogenase-like Hydrolases; Region:
                     HAD_like; cl21460"
                     /db_xref="CDD:451251"
     misc_feature    <353..>445
                     /gene="LOC111492385"
                     /note="plasma-membrane proton-efflux P-type ATPase;
                     Region: ATPase-IIIA_H; TIGR01647"
                     /db_xref="CDD:273731"
ORIGIN      
gccctagttaactgatatcccccaatcaaaactccgtgaaccctctccacttcttactcttcggaatcgtcctcctcttctttttcttctgttttctttcctcttctccgatggcgatcgtgacgattcttccatgaatctcgtggacttctcgtatttctaaatatactttcctcatcggacttctaattcttcatttcctaactcgagctctcgcgtatgccatcgagcttgcacttcgagaatgggcggagttaatgccatcactcttgaggagattaaaagcgagaccgttgatctggaacgtattccaatagaggaagtgtttgaacagttggaatgtacacgagaagaacacaaatgtgaattcgtgaaagggctgaaggaaaggaagcatatgtgtgcaatgacaggggatggtgttaatgatgcacctttctttaaagaaggcagatatcggaatggctgttgctgatgctactgatgcagccagagtgcttcagatattgttcgtacagaacc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]