LOCUS       XM_023042150             360 bp    mRNA    linear   PLN 19-NOV-2017
DEFINITION  PREDICTED: Olea europaea var. sylvestris calcium-transporting
            ATPase 5, plasma membrane-type-like (LOC111411632), mRNA.
ACCESSION   XM_023042150
VERSION     XM_023042150.1
DBLINK      BioProject: PRJNA417827
KEYWORDS    RefSeq.
SOURCE      Olea europaea var. sylvestris
  ORGANISM  Olea europaea var. sylvestris
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; asterids; lamiids; Lamiales; Oleaceae; Oleeae; Olea.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_036238.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Olea europaea var. sylvestris
                                           Annotation Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..360
                     /organism="Olea europaea var. sylvestris"
                     /mol_type="mRNA"
                     /variety="sylvestris"
                     /sub_species="europaea"
                     /db_xref="taxon:158386"
                     /chromosome="2"
                     /clone="OG-1"
                     /tissue_type="leaf"
                     /country="Turkey: Bursa, Orhangazi"
     gene            1..360
                     /gene="LOC111411632"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 14 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:111411632"
     CDS             79..345
                     /gene="LOC111411632"
                     /codon_start=1
                     /product="calcium-transporting ATPase 5, plasma
                     membrane-type-like"
                     /protein_id="XP_022897918.1"
                     /db_xref="GeneID:111411632"
                     /translation="

MRKMMADKALVRRLSACETMGSATTICSDKTGTLTLNEMTVVDVFACGKKIEPPDNKSLLPPNVMSLLLEGISQNTTGSIYVPEVGYC"

     misc_feature    <79..>309
                     /gene="LOC111411632"
                     /note="plasma-membrane calcium-translocating P-type
                     ATPase; Region: ATPase-IIB_Ca; TIGR01517"
                     /db_xref="CDD:273668"
ORIGIN      

actgttgcagtgaccattgtagttgttgcagtacctgaagggcttccattggctgtcactctgacgcttgcctattcaatgagaaaaatgatggcagacaaggccttggtcaggaggctatcagcctgtgaaaccatgggctctgcaacaactatttgcagcgataaaaccgggaccctaactttgaatgagatgactgtggttgatgtgtttgcttgtgggaagaagattgaaccccctgacaataagtcactgcttcctcctaatgttatgtctctgcttcttgaaggcatttcacagaatacaactggcagcatatatgtccctgaggtgggttattgctaaatagcaaccatttag

//