GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-19 06:53:49, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_022977706             537 bp    mRNA    linear   INV 04-NOV-2017
DEFINITION  PREDICTED: Spodoptera litura small proline-rich protein 2H-like
            (LOC111361326), mRNA.
ACCESSION   XM_022977706
VERSION     XM_022977706.1
DBLINK      BioProject: PRJNA416314
KEYWORDS    RefSeq.
SOURCE      Spodoptera litura
  ORGANISM  Spodoptera litura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Lepidoptera; Glossata;
            Ditrysia; Noctuoidea; Noctuidae; Amphipyrinae; Spodoptera.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_036189.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Spodoptera litura Annotation Release
                                           100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..537
                     /organism="Spodoptera litura"
                     /mol_type="mRNA"
                     /strain="Ishihara"
                     /db_xref="taxon:69820"
                     /chromosome="3"
                     /sex="male"
                     /tissue_type="whole body"
                     /dev_stage="moths"
     gene            1..537
                     /gene="LOC111361326"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 2 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111361326"
     CDS             18..365
                     /gene="LOC111361326"
                     /codon_start=1
                     /product="small proline-rich protein 2H-like"
                     /protein_id="XP_022833474.1"
                     /db_xref="GeneID:111361326"
                     /translation="
MMGLQAFLVLALISVAAAAPWRCYSTCDGSTVCIGETGQPSISPPSICIGRPCPPCTGPATVYTPCQCPCPCPPPPCPCPAPCPCPCPCPPPACPCPCPCPCPEPPPPACPCPCY"
ORIGIN      
tatgtacggattcggcaatgatgggtctacaggcttttctggtacttgctctgatcagcgtagcagcagcagcgccatggaggtgttatagtacatgcgacggcagcacagtatgcattggagaaactggacagccatccatcagcccaccctcgatctgcatcggcaggccttgcccaccatgcacaggaccagccactgtctacaccccgtgccagtgcccttgcccttgccctcccccaccctgcccatgccccgctccctgcccatgcccgtgcccatgcccacccccagcctgtccttgcccgtgcccttgcccctgtccagagccaccaccaccagcatgcccctgcccctgctactaaataaataagagaaaaatattttggatatcattttttggataatatgattttatttttagaattggaacgaaataaaaaatttgaatttttttttcaaaaaaatgtaatcgtttttttggtatagaaaatatgtcattggtatttggatttggaaaaaaaataatatattgaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]