2024-05-19 06:53:49, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_022977706 537 bp mRNA linear INV 04-NOV-2017 DEFINITION PREDICTED: Spodoptera litura small proline-rich protein 2H-like (LOC111361326), mRNA. ACCESSION XM_022977706 VERSION XM_022977706.1 DBLINK BioProject: PRJNA416314 KEYWORDS RefSeq. SOURCE Spodoptera litura ORGANISM Spodoptera litura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Noctuoidea; Noctuidae; Amphipyrinae; Spodoptera. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_036189.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Spodoptera litura Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.4 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..537 /organism="Spodoptera litura" /mol_type="mRNA" /strain="Ishihara" /db_xref="taxon:69820" /chromosome="3" /sex="male" /tissue_type="whole body" /dev_stage="moths" gene 1..537 /gene="LOC111361326" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns" /db_xref="GeneID:111361326" CDS 18..365 /gene="LOC111361326" /codon_start=1 /product="small proline-rich protein 2H-like" /protein_id="XP_022833474.1" /db_xref="GeneID:111361326" /translation="
MMGLQAFLVLALISVAAAAPWRCYSTCDGSTVCIGETGQPSISPPSICIGRPCPPCTGPATVYTPCQCPCPCPPPPCPCPAPCPCPCPCPPPACPCPCPCPCPEPPPPACPCPCY"
ORIGIN
tatgtacggattcggcaatgatgggtctacaggcttttctggtacttgctctgatcagcgtagcagcagcagcgccatggaggtgttatagtacatgcgacggcagcacagtatgcattggagaaactggacagccatccatcagcccaccctcgatctgcatcggcaggccttgcccaccatgcacaggaccagccactgtctacaccccgtgccagtgcccttgcccttgccctcccccaccctgcccatgccccgctccctgcccatgcccgtgcccatgcccacccccagcctgtccttgcccgtgcccttgcccctgtccagagccaccaccaccagcatgcccctgcccctgctactaaataaataagagaaaaatattttggatatcattttttggataatatgattttatttttagaattggaacgaaataaaaaatttgaatttttttttcaaaaaaatgtaatcgtttttttggtatagaaaatatgtcattggtatttggatttggaaaaaaaataatatattgaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]