LOCUS       XM_022781668             409 bp    mRNA    linear   PLN 12-OCT-2017
DEFINITION  PREDICTED: Vigna radiata var. radiata plasma membrane ATPase 2-like
            (LOC106763428), transcript variant X1, mRNA.
ACCESSION   XM_022781668
VERSION     XM_022781668.1
DBLINK      BioProject: PRJNA301363
KEYWORDS    RefSeq.
SOURCE      Vigna radiata var. radiata (mung bean)
  ORGANISM  Vigna radiata var. radiata
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50
            kb inversion clade; NPAAA clade; indigoferoid/millettioid clade;
            Phaseoleae; Vigna.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_028356.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Vigna radiata Annotation Release 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..409
                     /organism="Vigna radiata var. radiata"
                     /mol_type="mRNA"
                     /variety="radiata"
                     /cultivar="VC1973A"
                     /db_xref="taxon:3916"
                     /chromosome="6"
                     /tissue_type="leaf"
     gene            1..409
                     /gene="LOC106763428"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 5 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:106763428"
     CDS             161..406
                     /gene="LOC106763428"
                     /codon_start=1
                     /product="plasma membrane ATPase 2-like"
                     /protein_id="XP_022637389.1"
                     /db_xref="GeneID:106763428"
                     /translation="

MITEHKYEIVKRLQARKHICGMTGDGVNDAPALKKAGIGIVVADATDAARSASDIVLTEPGLSVIFIIVLVNVAPEKRIKY"

     misc_feature    <170..>355
                     /gene="LOC106763428"
                     /note="plasma-membrane proton-efflux P-type ATPase;
                     Region: ATPase-IIIA_H; TIGR01647"
                     /db_xref="CDD:273731"
ORIGIN      

cttggctttctccgttttatacaagacgttctagatggaaacaaagagagtataggtggcccatggcagtttattggcctttggcctctgtttgacccaccctaggcatgacagtgcagaaacaatacgcagggcacttaaccttggagtcaatgttaaaatgattacagagcacaagtacgagattgtgaaacgtttgcaagctaggaaacatatttgtggaatgactggtgatggagtgaatgacgcacctgcactcaagaaggccggcattggtatagttgttgctgacgcaactgatgcagctcggagtgcatctgatattgttttaacagaacctggccttagtgttattttcattattgtattagtgaatgttgctcctgaaaagagaataaaatattagttc

//