LOCUS       XM_021741226            2075 bp    mRNA    linear   PLN 28-SEP-2021
DEFINITION  PREDICTED: Manihot esculenta guanine nucleotide-binding protein
            subunit gamma 3 (LOC110603484), mRNA.
ACCESSION   XM_021741226
VERSION     XM_021741226.2
DBLINK      BioProject: PRJNA394209
KEYWORDS    RefSeq.
SOURCE      Manihot esculenta (cassava)
  ORGANISM  Manihot esculenta
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae;
            Crotonoideae; Manihoteae; Manihot.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_035176.2) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 28, 2021 this sequence version replaced XM_021741226.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Manihot esculenta Annotation Release
                                           101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2075
                     /organism="Manihot esculenta"
                     /mol_type="mRNA"
                     /cultivar="AM560-2"
                     /db_xref="taxon:3983"
                     /chromosome="16"
                     /tissue_type="leaf"
                     /dev_stage="seedling"
                     /country="Colombia"
     gene            1..2075
                     /gene="LOC110603484"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 7 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 53 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:110603484"
     CDS             991..1887
                     /gene="LOC110603484"
                     /codon_start=1
                     /product="guanine nucleotide-binding protein subunit gamma
                     3"
                     /protein_id="XP_021596918.1"
                     /db_xref="GeneID:110603484"
                     /translation="

MAESYRVVTASKSGCSSSVPSLPPPRPKSPPKYPDLYGKRREMAKVQMLEREIGFLEEELKSVDSLQPASRCCKEVTEFVVANPDPLILTSRKNRRSCRFWKWLCGIPCFNFSWICCCCYSGCSFHIHLPRCCDCNCDCNPCDLCNCCSCFRCPAPKWRCCSFRSCCPCTCSSCCPCSCSDCCPCSCSCPCPCPCPCPCSCSCPCPCPCPCSCSCPKSSCCKNISCCSDCCRCGLPSCPDCSCCSCPKCSNCSCCTSLCCCPKWTCSAPKCPKRPKCPKVRLCCNCTKTSCNPCCLFF"

     misc_feature    1126..1320
                     /gene="LOC110603484"
                     /note="GGL domain; Region: G-gamma; pfam00631"
                     /db_xref="CDD:425787"
     polyA_site      2075
                     /gene="LOC110603484"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      

aatttgatgaaaggatgaaatcttggaggagatgaagaaatggcaaagattccaagcaaaaggcaaccaacaattggatcaaaacatcatcatattactaccgattttggtcatagtctctggtttgtctcaaaatcagagcagattccggggttcaaaaacccaactccgtcctccattacccaaatttaaaaaaaaaaaaaactttctctctctcctacgcagccatcacgtgtccatctcaggtactacatcgtgtttttcgcttggcctctgcaaccaccaccccaccagcgagacactggctcagaaaataatacacccacaccgcagagatattgcagagcaacagagaaggagcggagacttctgggctctcaaaaactcactcaaattcgatcaagactctttctttttaaaattttttttatcaagcaaaaaattttgcaaaatgggttcgtactcagagttgcaggcttttccaccagccgtctttaccattattaccactatcattattaccatgcacaaaggttgtgtctccagaaatatcagatctctccctctccacgcacagtctgtgataataatgactctctttttatccttattatctctctttttactctctcttaattctcccgttaatcttctctgcctgcaaccataatcgccttctgctataaatgacacatttacatccatgtactgctctgctctagtttcagctcctgccgctgctctctctttttttcctcctttcctttcttttcttttcttttctttttctcttctgcgttgcagatgatttaattactgcctctgccacactctaagctttcgtttgctatagcatttgcaacctaacgttacttctttgtcccttactatttgctacttggggttgctttgttacttcttcttcttcttgtactacttgcctgctctcattttcgcttcttcttttgagttttcttcgagaaaaataaaatggcagaaagttatagagtagtgacagcatccaagtcgggttgctcttcctcagtgccgtcgttgcctcctcctcgcccaaagtctccgcccaagtatcccgatttgtatggcaagcgcagggaaatggctaaggtgcagatgcttgagagagaaatcggttttctagaggaggaactaaaatctgttgacagcctccagcctgcatccagatgctgcaaagaggtcactgaatttgtggttgcaaacccagatcctttaatacttacaagtagaaagaatcgaaggtcttgtcgattttggaagtggctatgtggaataccctgctttaacttctcatggatttgttgttgctgctactcgggatgctcttttcacatacacttaccgcgctgctgcgactgcaactgtgactgtaatccgtgtgacctatgtaactgctgttcatgttttcgctgtccagcacccaagtggcggtgttgctctttccggagctgttgcccttgcacttgctcaagctgttgcccttgctcttgctcggactgttgcccatgctcttgctcttgtccttgcccttgcccttgcccttgcccttgctcttgctcttgcccttgcccttgcccttgcccttgctcttgctcctgtcctaaatccagttgctgtaaaaacatctcatgctgcagtgactgctgcagatgcggacttccctcgtgcccagattgctcttgctgttcatgcccaaaatgcagcaattgcagttgctgcacctcgttatgttgttgtcctaaatggacatgctctgctcctaaatgtccgaaacgccccaagtgtcctaaggtacgtctttgttgcaattgtacaaaaacatcttgtaatccatgttgtctattcttttagcataattaagttatgcagtattggagaaagccttatctccaataataccattcaatttctacagagagtttaggaacttgtaatttattttgcttgcttgtttgttttcagcttcaaatatcctaagattttgctaataaacactcaaaaagccttgctcagtgattaatctgagatgatttatttca

//