2024-05-19 03:30:16, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_021505066 1980 bp mRNA linear INV 17-JUN-2017 DEFINITION PREDICTED: Mizuhopecten yessoensis agrin-like (LOC110455117), transcript variant X1, mRNA. ACCESSION XM_021505066 VERSION XM_021505066.1 DBLINK BioProject: PRJNA390633 KEYWORDS RefSeq. SOURCE Mizuhopecten yessoensis (Yesso scallop) ORGANISM Mizuhopecten yessoensis Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Mollusca; Bivalvia; Autobranchia; Pteriomorphia; Pectinida; Pectinoidea; Pectinidae; Mizuhopecten. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_018407394.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Mizuhopecten yessoensis Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.4 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1980 /organism="Mizuhopecten yessoensis" /mol_type="mRNA" /strain="PY_sf001" /db_xref="taxon:6573" /chromosome="Unknown" /sex="male" /tissue_type="whole organism" gene 1..1980 /gene="LOC110455117" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns" /db_xref="GeneID:110455117" CDS 93..1619 /gene="LOC110455117" /codon_start=1 /product="agrin-like" /protein_id="XP_021360741.1" /db_xref="GeneID:110455117" /translation="
MSVMMSYILSVVGLSLLLAPLVVDCQKTCNATSGRVCGAKFTTKTFKNECKVKRKFNVIYSGKCSGDCVCQQDYTPVCGVDGKTYSNDCSAGCKGVAVACIGKCPCDCICTREFAPVCGVNGETYGNACVAGCHGVAIKCKGKCPCPCICTLEYNPVCGADGNTYSNKCGADCAGVAVNCVGKCPCDCVCTLQYDPVCGTDGKTYGNECFATKCHGVGIACKEKCPCPCICTADYNPVCGVDGKTYSNTCRAGCAGVAVNCVGKCPCGCKCTLQYDPVCGIDGNTYGNECVATECHGVGIACKQKCPCPCFCPQVFIPVCGVDNKTYGNACEAACENVPVECAGECPCGCVCTKEYNPVCGYDGKTYGNPCMAKCQGAAIRCKQQCPCPCLCTKEFRPVCGVDGKTYDNKCLAAWNYTRVECSGPCPCNCKCPKVYIPVCGENGETYGNTCVATCLGVAIRCNGKCPCPCPCPKILAPVCGEDGETYNNKCLANCERVPVACTGRCPC"
misc_feature <282..542 /gene="LOC110455117" /note="Major Facilitator Superfamily; Region: MFS; cl28910" /db_xref="CDD:452895" misc_feature 528..>614 /gene="LOC110455117" /note="Kazal type serine protease inhibitors and follistatin-like domains. Kazal inhibitors inhibit serine proteases, such as, trypsin, chyomotrypsin, avian ovomucoids, and elastases. The inhibitory domain has one reactive site peptide bond, which serves the...; Region: KAZAL_FS; cl00097" /db_xref="CDD:412159" misc_feature 648..>722 /gene="LOC110455117" /note="Kazal type serine protease inhibitors; Region: KAZAL; smart00280" /db_xref="CDD:197624" misc_feature <753..962 /gene="LOC110455117" /note="Major Facilitator Superfamily; Region: MFS; cl28910" /db_xref="CDD:452895" misc_feature <1026..1394 /gene="LOC110455117" /note="Major Facilitator Superfamily; Region: MFS; cl28910" /db_xref="CDD:452895" misc_feature <1365..1457 /gene="LOC110455117" /note="Major Facilitator Superfamily; Region: MFS; cl28910" /db_xref="CDD:452895" ORIGIN
tcggtggcgctcgcaagtttggagagtacagaaccgtttgttggattataaaggtagtctttgctttactcatagctacatatgctttacagatgtcagtgatgatgtcatatatcttgagtgtggtaggactgtcgctccttctcgcacctctggttgttgattgtcaaaaaacatgtaacgcaacaagcgggcgtgtctgtggtgcaaaatttactacaaagacgtttaagaacgaatgcaaagttaaaaggaagttcaacgttatctattccggaaaatgtagtggagactgcgtttgtcagcaggattataccccagtatgtggagtagatggcaaaacgtacagcaacgactgttccgctggctgcaagggtgttgcagtagcttgcatcgggaaatgtccatgtgactgtatctgcacccgcgagtttgctcccgtttgtggtgtgaatggcgagacctatggtaacgcatgtgttgcaggatgtcatggtgttgcaatcaaatgtaaggggaagtgcccgtgtccgtgtatttgcacactagagtataaccccgtatgtggagcggacggcaacacctacagcaacaagtgtggcgcggactgtgctggtgttgctgtgaattgtgtcggtaaatgtccatgtgactgtgtgtgtaccttacaatacgatcctgtttgtggaacagatgggaagacttacggtaacgaatgcttcgcaacaaaatgtcatggtgttgggattgcctgcaaagagaaatgcccctgtccgtgtatttgtacagcagattataacccggtgtgtggggtggacggcaaaacctacagcaacacgtgtcgcgctggctgtgctggtgttgctgtgaactgtgtcggtaaatgtccatgtggctgtaaatgtaccttacaatacgatcctgtttgtggaatagacgggaacacgtacggcaacgaatgcgtcgcaacagagtgtcacggcgttggcattgcatgcaagcagaagtgcccttgtccatgtttctgcccacaagtgtttatcccggtatgtggggtggacaataaaacatacggaaacgcgtgtgaagcagcatgtgagaatgtacctgtggaatgtgctggcgaatgcccctgtggctgcgtttgtactaaagagtataacccggtgtgtgggtacgatggtaagacgtacggaaacccatgcatggcaaaatgtcaaggtgcggccatacgatgtaaacaacaatgtccctgcccatgtttgtgtacgaaagagttccgaccagtgtgcggtgttgacgggaaaacatatgataacaaatgtttagcagcttggaactatacccgtgttgagtgttccggcccatgtccttgtaattgtaaatgcccgaaagtctacatcccagtttgtggagaaaatggggaaacgtacggaaacacatgcgtagctacatgtctaggcgtagccattcgctgcaacgggaaatgtccatgtccatgtccatgtccaaaaatattggctccagtgtgtggtgaagatggagaaacgtacaacaataaatgccttgccaattgcgagagggtacctgttgcatgtacagggagatgcccatgctgaagaggttaacctatacagatacatgatatgcatgctagatgcaggaatgccacggttctctgcgttcctatcttggaagaacagttggaaaatgcggaattgcatgtgaatttcacaaaatcgtacgctacaaataaacagttatttgaatttattttagtattatttatcattgaattaatcaccacacgagaataaatgctatttctagatatagatatacacaaaaacttatacatttactgccaaaccatccagatttaagatctcactcaagtaacaagtaacgtttatgtttttttcttgtctgcaatcattcaaccaccttagatttttgcaaagaaaaaaatcatattgctta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]