GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-19 05:01:41, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_021504527            1086 bp    mRNA    linear   INV 17-JUN-2017
DEFINITION  PREDICTED: Mizuhopecten yessoensis putative proline-rich protein 21
            (LOC110454808), mRNA.
ACCESSION   XM_021504527
VERSION     XM_021504527.1
DBLINK      BioProject: PRJNA390633
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Mizuhopecten yessoensis (Yesso scallop)
  ORGANISM  Mizuhopecten yessoensis
            Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Mollusca; Bivalvia;
            Autobranchia; Pteriomorphia; Pectinida; Pectinoidea; Pectinidae;
            Mizuhopecten.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_018407364.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Mizuhopecten yessoensis Annotation
                                           Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1086
                     /organism="Mizuhopecten yessoensis"
                     /mol_type="mRNA"
                     /strain="PY_sf001"
                     /db_xref="taxon:6573"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole organism"
     gene            1..1086
                     /gene="LOC110454808"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein"
                     /db_xref="GeneID:110454808"
     CDS             1..1086
                     /gene="LOC110454808"
                     /codon_start=1
                     /product="putative proline-rich protein 21"
                     /protein_id="XP_021360202.1"
                     /db_xref="GeneID:110454808"
                     /translation="
MSHCPCPIVHVSLSMSHYPCSNDHVPLSLPYCRSPNDTAPVSLPYCPCPTAHVPLSLPYCPCPTVPGSLSLPYCPCPTAHVPLSLPYCPCPTVHGSLSLPYCPCLTVPALLSLPYCPCPTVHAPLSLPYCPCFTVPALLSLPHCPCPTVHVPLSLPYCPCPIVPALLSMSHCPCPTIPVPMTMSHCPCPTVHVPLSLPYCPCFTVPALLSLPYCPCPTIHVSLSMSNYPCLTVHVPLSLPYFPCPTFPSLLSLSNCTCPTVPALLSLSYCPFPTVPVPLSLPYCPCPTIHVSLSMSNYPCLTVHVALSLPYCPCPTVHVSLSMSHYPCLTVHVPLSMPYCPCPTVPVLLSLPYCPCLTVHV"
ORIGIN      
atgtcccactgtccctgtccaattgtccatgtctcactgtctatgtcccactatccctgttccaatgaccatgtcccactgtccctgccctactgtcgcagtcccaatgacactgccccagtgtccctgccctactgtccctgccctactgcccatgtcccactgtccctgccctactgtccctgccctactgtccctggctcactgtccctgccctactgtccctgccctactgcccatgtcccactgtccctgccatactgtccctgccctactgtccatggctcactgtccctgccctactgtccctgcctcactgtccctgccctactgtccctgccctattgtccctgccctactgtccatgccccactgtccctgccctactgtccatgtttcactgtccctgccctactgtccctgccccattgtccctgccctactgtccatgtcccactgtccctgccctactgtccctgccctattgtccctgccctactgtccatgtctcactgtccatgtcccactatccctgtcccaatgacaatgtcccattgtccctgccctactgtccatgtcccactgtccctgccctactgtccatgtttcactgtccctgccctactgtccctgccctactgtccctgccctactatccatgtctcactgtccatgtccaactatccctgccttactgtccatgtcccactgtccctgccctactttccctgtcctactttcccctccctactatccctgtccaactgtacatgtcccactgtccctgccctactgtccctgtcctactgtcccttccctactgtccctgtcccactgtccctgccctactgtccctgccctactatccatgtctccctgtccatgtccaactatccctgccttactgtccatgtcgcactgtccctgccctactgtccctgccctactgtccatgtctcactgtccatgtcacactatccctgccttactgtccatgtcccactgtccatgccctactgtccctgccctactgtccctgtcctactgtccctgccctactgtccatgtctcactgtccatgtctaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]