2024-05-19 05:01:41, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_021504527 1086 bp mRNA linear INV 17-JUN-2017 DEFINITION PREDICTED: Mizuhopecten yessoensis putative proline-rich protein 21 (LOC110454808), mRNA. ACCESSION XM_021504527 VERSION XM_021504527.1 DBLINK BioProject: PRJNA390633 KEYWORDS RefSeq; includes ab initio. SOURCE Mizuhopecten yessoensis (Yesso scallop) ORGANISM Mizuhopecten yessoensis Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Mollusca; Bivalvia; Autobranchia; Pteriomorphia; Pectinida; Pectinoidea; Pectinidae; Mizuhopecten. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_018407364.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Mizuhopecten yessoensis Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.4 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1086 /organism="Mizuhopecten yessoensis" /mol_type="mRNA" /strain="PY_sf001" /db_xref="taxon:6573" /chromosome="Unknown" /sex="male" /tissue_type="whole organism" gene 1..1086 /gene="LOC110454808" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:110454808" CDS 1..1086 /gene="LOC110454808" /codon_start=1 /product="putative proline-rich protein 21" /protein_id="XP_021360202.1" /db_xref="GeneID:110454808" /translation="
MSHCPCPIVHVSLSMSHYPCSNDHVPLSLPYCRSPNDTAPVSLPYCPCPTAHVPLSLPYCPCPTVPGSLSLPYCPCPTAHVPLSLPYCPCPTVHGSLSLPYCPCLTVPALLSLPYCPCPTVHAPLSLPYCPCFTVPALLSLPHCPCPTVHVPLSLPYCPCPIVPALLSMSHCPCPTIPVPMTMSHCPCPTVHVPLSLPYCPCFTVPALLSLPYCPCPTIHVSLSMSNYPCLTVHVPLSLPYFPCPTFPSLLSLSNCTCPTVPALLSLSYCPFPTVPVPLSLPYCPCPTIHVSLSMSNYPCLTVHVALSLPYCPCPTVHVSLSMSHYPCLTVHVPLSMPYCPCPTVPVLLSLPYCPCLTVHV"
ORIGIN
atgtcccactgtccctgtccaattgtccatgtctcactgtctatgtcccactatccctgttccaatgaccatgtcccactgtccctgccctactgtcgcagtcccaatgacactgccccagtgtccctgccctactgtccctgccctactgcccatgtcccactgtccctgccctactgtccctgccctactgtccctggctcactgtccctgccctactgtccctgccctactgcccatgtcccactgtccctgccatactgtccctgccctactgtccatggctcactgtccctgccctactgtccctgcctcactgtccctgccctactgtccctgccctattgtccctgccctactgtccatgccccactgtccctgccctactgtccatgtttcactgtccctgccctactgtccctgccccattgtccctgccctactgtccatgtcccactgtccctgccctactgtccctgccctattgtccctgccctactgtccatgtctcactgtccatgtcccactatccctgtcccaatgacaatgtcccattgtccctgccctactgtccatgtcccactgtccctgccctactgtccatgtttcactgtccctgccctactgtccctgccctactgtccctgccctactatccatgtctcactgtccatgtccaactatccctgccttactgtccatgtcccactgtccctgccctactttccctgtcctactttcccctccctactatccctgtccaactgtacatgtcccactgtccctgccctactgtccctgtcctactgtcccttccctactgtccctgtcccactgtccctgccctactgtccctgccctactatccatgtctccctgtccatgtccaactatccctgccttactgtccatgtcgcactgtccctgccctactgtccctgccctactgtccatgtctcactgtccatgtcacactatccctgccttactgtccatgtcccactgtccatgccctactgtccctgccctactgtccctgtcctactgtccctgccctactgtccatgtctcactgtccatgtctaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]