LOCUS       XM_021295168            1064 bp    mRNA    linear   VRT 24-MAY-2017
DEFINITION  PREDICTED: Columba livia ST6 N-acetylgalactosaminide
            alpha-2,6-sialyltransferase 5 (ST6GALNAC5), transcript variant X1,
            mRNA.
ACCESSION   XM_021295168
VERSION     XM_021295168.1
DBLINK      BioProject: PRJNA217047
KEYWORDS    RefSeq.
SOURCE      Columba livia (rock pigeon)
  ORGANISM  Columba livia
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Columbiformes; Columbidae;
            Columba.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_004973463.1) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Columba livia Annotation Release 102
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1064
                     /organism="Columba livia"
                     /mol_type="mRNA"
                     /db_xref="taxon:8932"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="blood"
                     /country="Denmark: Vordingborg"
                     /collection_date="13-Jun-2010"
                     /breed="Danish Tumbler"
                     /note="bred by Anders Christiansen, Hans Ove Christiansen,
                     and certified by Danmarks Racedueforeninger"
     gene            1..1064
                     /gene="ST6GALNAC5"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 EST, 3 Proteins, and 100%
                     coverage of the annotated genomic feature by RNAseq
                     alignments, including 1 sample with support for all
                     annotated introns"
                     /db_xref="GeneID:102098304"
     CDS             123..875
                     /gene="ST6GALNAC5"
                     /codon_start=1
                     /product="alpha-N-acetylgalactosaminide
                     alpha-2,6-sialyltransferase 5 isoform X1"
                     /protein_id="XP_021150843.1"
                     /db_xref="GeneID:102098304"
                     /translation="

MHCKSCALVTSSGHLLGSKQGDRIDETECVIRMNDAPTRGYGKDVGNKTSVRVIAHSSIQRILRNRNELLNMSHGAVFIFWGPSSYMRRDGKGLVYNNLQLMNQILPQLKAYMISRHKMLQFDDLFKRETGKDRKISNTWLSTGWFTMTIALELCDRINVYGMVPPDFCSVQQRNREEPSSESFPAAEGGSQPNLPGAVRAELGPQHLPDFYCVGSKSVGDNDFNFTNPPSSTDLPLRPLPASVQKGRAG"

     misc_feature    126..623
                     /gene="ST6GALNAC5"
                     /note="Glycosyltransferase family 29 (sialyltransferase);
                     Region: Glyco_transf_29; pfam00777"
                     /db_xref="CDD:425864"
ORIGIN      

ggaggccgggtcagtaagtctgcctggtgtagttcgagacatgcttgttagcttgaatttggaagcagaatagacacagtgtatctgagcacgtaaatcctgacctttggcagcctttaaaaatgcactgcaagagttgtgcgttggtaaccagctctggacaccttctgggaagtaaacaaggtgacagaatcgacgagaccgagtgtgtaatacgaatgaacgatgcacctactcgaggttacggaaaagatgttggaaacaaaacgagcgttcgagtcattgcacactccagtattcagaggattttgcggaatcgcaatgaactcttaaatatgagccacggtgctgtgtttatcttctggggtcccagcagctacatgaggagagatggtaaaggcttggtgtataataacctccagctgatgaatcagatactgcctcaattaaaagcatatatgatttctcgccacaagatgcttcaatttgatgacctttttaaacgggaaactgggaaagacaggaagatctccaacacttggcttagcacgggctggttcacaatgactatcgcattagagctctgtgacaggataaatgtttatggcatggtgccaccggatttctgcagcgtacagcaaaggaatagggaagagccatccagcgaatcatttcctgcagcagaggggggatcccagccaaacctacctggtgctgtgagggcagaactgggccctcagcacttacctgatttctactgcgttggttcaaagtctgttggagataacgatttcaacttcactaatccaccaagcagcacagatttacccttgagaccacttccagcttcagtgcagaaaggaagagcaggctaaacgagacacagaggcctatttgtttagtggttcttaagaaaaacacaaatcacataaatgtatcttgttagatttacagtaaccatacatatgatttgtttaagagattataacaattgtccaatgtatcaaaaaagtatgtgaaaaattaattgaagatttagatttaatagttctagctaaaaaaaa

//