LOCUS       XM_021124052             455 bp    mRNA    linear   PLN 13-MAY-2017
DEFINITION  PREDICTED: Arachis ipaensis uncharacterized LOC110272166
            (LOC110272166), mRNA.
ACCESSION   XM_021124052
VERSION     XM_021124052.1
DBLINK      BioProject: PRJNA316874
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Arachis ipaensis
  ORGANISM  Arachis ipaensis
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50
            kb inversion clade; dalbergioids sensu lato; Dalbergieae;
            Pterocarpus clade; Arachis.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_029789.2) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Arachis ipaensis Annotation Release
                                           101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 11% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..455
                     /organism="Arachis ipaensis"
                     /mol_type="mRNA"
                     /cultivar="K30076"
                     /db_xref="taxon:130454"
                     /chromosome="B05"
                     /tissue_type="whole plant"
                     /country="Bolivia: Tarija, Quebrada de Thaiguate (30 km N
                     of Villa Montes)"
                     /collection_date="2012"
     gene            1..455
                     /gene="LOC110272166"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 90% coverage of the annotated
                     genomic feature by RNAseq alignments, including 51 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:110272166"
     CDS             96..455
                     /gene="LOC110272166"
                     /codon_start=1
                     /product="uncharacterized protein LOC110272166"
                     /protein_id="XP_020979711.1"
                     /db_xref="GeneID:110272166"
                     /translation="

MASRDQSEKLKWSSQLYEECHRYLASLNIEYHPFIMRPSAGSSFDGLEKSIVEIETRLEVGEPPNDKGTECSSNAGGAPSDLEDLSNGDGVNDSQEPKVDVNGNTEEKRRHFVEKMRGP"

ORIGIN      

aaaacaacaaatctgtggtgtaccatggaagcaaattgctttacatatatcttgagacgtcatgtgaaaaagaagcatggtgtaaggccctccgtatggcttcacgcgatcagagtgaaaaacttaagtggtctagtcagttgtatgaagagtgtcatcgatatctagcatcactaaatattgaatatcatccttttatcatgagaccatcagcaggatcaagttttgatggcttagaaaagtccatagtagagattgaaacaaggcttgaagttggtgaaccaccgaacgataaggggacggaatgctcaagcaatgctgggggtgccccgtcagatcttgaagatcttagcaatggagacggagtgaatgattcacaagagccaaaagtagatgtcaatgggaacactgaagaaaagaggcgtcactttgttgaaaagatgagaggaccatga

//