GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-19 03:52:37, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_021046986            1636 bp    mRNA    linear   INV 21-NOV-2023
DEFINITION  PREDICTED: Exaiptasia diaphana vegetative cell wall protein gp1
            (LOC110241140), mRNA.
ACCESSION   XM_021046986
VERSION     XM_021046986.2
DBLINK      BioProject: PRJNA386175
KEYWORDS    RefSeq.
SOURCE      Exaiptasia diaphana
  ORGANISM  Exaiptasia diaphana
            Eukaryota; Metazoa; Cnidaria; Anthozoa; Hexacorallia; Actiniaria;
            Aiptasiidae; Exaiptasia.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_018385916.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Apr 17, 2019 this sequence version replaced XM_021046986.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_001417965.1-RS_2023_11
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.2
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 11/03/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1636
                     /organism="Exaiptasia diaphana"
                     /mol_type="mRNA"
                     /isolate="CC7"
                     /isolation_source="whole animal"
                     /db_xref="taxon:2652724"
                     /chromosome="Unknown"
                     /country="Saudi Arabia: KAUST"
                     /collection_date="Mar-2014"
     gene            1..1636
                     /gene="LOC110241140"
                     /note="vegetative cell wall protein gp1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 6 Proteins, and 100% coverage of the annotated genomic
                     feature by RNAseq alignments, including 3 samples with
                     support for all annotated introns"
                     /db_xref="GeneID:110241140"
     CDS             7..1497
                     /gene="LOC110241140"
                     /codon_start=1
                     /product="vegetative cell wall protein gp1"
                     /protein_id="XP_020902645.1"
                     /db_xref="GeneID:110241140"
                     /translation="
MASLGQYMGFALLLILHNQSAARGHGKRVKINGEDSNFKESKLXESSLKVNERTNAIANXVPGGSDTDKGHGKXSTLLSGSTWSKASNGVAGSTGLKPGSTPGFGELSKLVGTSGKVLDDDISQIYEKIVHPKFPKQYPCSSPASNKCKKCTSTAACPCPAPAPTPCTVSSSSPCPAPAPSPCPSTEPCPCPSPCPPPCLPPCPPPCPPPCPPPPCLPPPDPPTTVPTTKPTTDPTTAGTTPTPTKPTPDPTPPPVESPYPCPCPCPCPCPCPCPAPCPCPAPCPSPTPSPSPAPCPVPSXCSPCCTPCPTPSPSPSPSPSNPSPSPCPSPSPSPSSSNPFPKPCNCLSPSTSRSPCPXPSPSPTPNPSPALNPCPCPCPAPSPXPNPSPYPSPSPNPSPTPYPCPCPCPSPLPSPSPSPNPSPYPSPSPNPSPTHYPCPCPCPSPSPSYSPTHRPSYSPFLPARLASSRNRDPSQSPYIYLDGTPKEYHWKTILN"
ORIGIN      
ccgaagatggcttctcttggccagtacatgggttttgcactgctacttattttgcataatcaaagtgcggcacgtgggcatggaaaaagagtaaaaataaacggggaagattccaacttcaaagaatccaaattgmaagaatccagcttgaaagtaaatgaaagaacaaatgctatagcgaacgrggtaccaggaggaagcgacacggacaagggtcacggaaaagrgtctactttactttccggatctacttggtctaaggcatctaatggagttgctggatctactggattaaaacctggatctacgcctggatttggtgagctttcaaaacttgtcggtacttcaggaaaggtgctggacgatgatatttcacaaatttatgaaaagatcgtgcatcccaagtttccaaaacaatatccctgttcatcgccagcatcaaacaagtgcaagaaatgtacgtctacagcggcctgtccatgtcctgctccagcgcctaccccgtgtactgtttcatcgtccagcccgtgtcctgctccagcgccttccccgtgtccctctacggagccctgtccatgtccttcaccttgtcctccaccctgtcttccaccctgtcctccaccctgtcctccaccctgtccgccaccaccgtgtcttcctcctcctgatcctccaacaacagttcctacgacaaaacctacaactgatcctacgacagctggaactactcctactcctacaaaacctacaccagatcctacacctccacctgtcgagtcaccctatccatgtccatgcccttgtccttgcccatgtccttgtccttgtccagcaccatgtccttgtcctgcaccatgtccctcgccaactccatctcctagtccagcaccttgyccggtaccttctmcatgttctccatgttgtactccatgtccaaccccatctccctcaccctcgccttctccttcaaatccttccccgtcgccatgtccgtctccttcaccatctccatcatcttcaaacccttttccaaaaccttgcaattgtctgtctccttcaacttcccggtctccttgtccttstccatccccatctccaacacctaatccttctccagcactaaatccatgtccttgtccatgtcctgcaccatctccgcmccctaatccttccccctatccatctccgtctcctaatccatctccgacaccttatccatgtccttgtccgtgtccttcaccattaccatcaccatctccgtcccccaatccttctccctatccatctccgtctcctaatccatctccaacacattatccatgcccatgcccatgtccttcaccatctccttcctattctccaactcatcgtccatcctattctccatttcttcctgcaaggctagcttcatctcgtaatcgagatccttcccagtctccatacatatatctggatggcactccgaaagagtatcactggaaaacaatmttgaattgaacttgagcatggtgtgggatgaataagttaccatgatctgtctccagggtcgtgcaccaactcagtatctattgcaaagctatagctgttaggatgactctaaataaaaccaaatctaattaaacattatgtaaattag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]