LOCUS       XM_020549347             365 bp    mRNA    linear   PLN 31-AUG-2020
DEFINITION  PREDICTED: Zea mays cation-transporting ATPase HMA5-like
            (LOC103647296), mRNA.
ACCESSION   XM_020549347
VERSION     XM_020549347.3
DBLINK      BioProject: PRJNA655717
KEYWORDS    RefSeq.
SOURCE      Zea mays
  ORGANISM  Zea mays
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; PACMAD
            clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae;
            Zea.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_050097.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Aug 31, 2020 this sequence version replaced XM_020549347.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Zea mays Annotation Release 103
            Annotation Version          :: 103
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..365
                     /organism="Zea mays"
                     /mol_type="mRNA"
                     /cultivar="B73"
                     /db_xref="taxon:4577"
                     /chromosome="2"
     gene            1..365
                     /gene="LOC103647296"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 247
                     samples with support for all annotated introns"
                     /db_xref="GeneID:103647296"
     CDS             71..328
                     /gene="LOC103647296"
                     /codon_start=1
                     /product="cation-transporting ATPase HMA5-like"
                     /protein_id="XP_020404936.1"
                     /db_xref="GeneID:103647296"
                     /translation="

MDLGDFLTLVASAEASSEHPLAKAILDYALHFHFFGKLPSSKDGIEQRKDKVLSQWLLEAEDFSAVSGKGVQCSINGKHVLVSHR"

     misc_feature    <71..>316
                     /gene="LOC103647296"
                     /note="Haloacid Dehalogenase-like Hydrolases; Region:
                     HAD_like; cl21460"
                     /db_xref="CDD:451251"
ORIGIN      

ggtttttgataaaacagggacactaacacaaggaaaggctgttgtaacagctgcaaaggttttctcgggaatggacctaggagatttcctcacgctggttgcatcagcagaggcaagcagtgagcatcctcttgccaaagctattttggactatgcattgcatttccatttctttggcaagcttccttcatcaaaagatggcattgagcaacgaaaagacaaggtattatcccagtggctgcttgaagctgaagacttctctgcagtatctggcaaaggagttcagtgctcgatcaatgggaagcatgttttggtgagtcataggtgaatgtcatgcttccatatcccttttaatttacattgtc

//