2024-05-19 10:06:45, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_020152873 1809 bp mRNA linear ROD 15-FEB-2017 DEFINITION PREDICTED: Castor canadensis copper-transporting ATPase 2-like (LOC109676481), partial mRNA. ACCESSION XM_020152873 VERSION XM_020152873.1 DBLINK BioProject: PRJNA371604 KEYWORDS RefSeq. SOURCE Castor canadensis (American beaver) ORGANISM Castor canadensis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Castorimorpha; Castoridae; Castor. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_017882540.1) annotated using gene prediction method: Gnomon, supported by mRNA evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Castor canadensis Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.3 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on the 3' end. FEATURES Location/Qualifiers source 1..1809 /organism="Castor canadensis" /mol_type="mRNA" /isolate="Ward" /db_xref="taxon:51338" /chromosome="Unknown" /sex="male" /tissue_type="Leukocyte" /dev_stage="adult" gene 1..>1809 /gene="LOC109676481" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 12 Proteins, and 82% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns" /db_xref="GeneID:109676481" CDS 40..>1809 /gene="LOC109676481" /codon_start=1 /product="copper-transporting ATPase 2-like" /protein_id="XP_020008462.1" /db_xref="GeneID:109676481" /translation="
MKQSFAFDNVGYEGSLDGICSSPTTSSTISILGMTCQSCVKSIEDRISSLKGVVSIKVSLEQGSAAVKYVPSIMSLQQICHQVGDMGFEASIAEGRAASWPSRSSSAQEAVVKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVTDMGFEAAIKNKMAPLSLGPIDVSRLESTNPKRLSAFANQNFNNSETSKYQGNHVATLQLGIEGMHCKSCVLNIEGNIGQLSGVQNIQVSLENKTAQVQYDPSLITPLSLKRAIEALPPGNFKVSLPDGAEESGPETGSSEIPSHGSPQRNQMQDACRTVVLSVTGMTCASCVQSIEGTVSQREGVWQISVSLAEGTGTILYDPSVITPEELRAAVEDMGFEASVIPENYSTSHVRNDSAGNSMLQTTGSTLGSVKEVAPCVRVLPENHGPGHSSNTPPPTSTVAPQKCFLQVKGMTCASCVSNIERNLQKEAGILSVLVALMSGKAEVKYNPEVIQPPTIAQLIQDLGFEATVMEDNAGSDGDIELIITGMTCASCVHNIESRLTRTNGITYASVALATSKAHVKFDPEIIGPRDIVKIIE"
misc_feature 136..312 /gene="LOC109676481" /note="Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain...; Region: HMA; cd00371" /db_xref="CDD:238219" misc_feature order(139..147,154..156) /gene="LOC109676481" /note="metal-binding site [ion binding]" /db_xref="CDD:238219" misc_feature 376..567 /gene="LOC109676481" /note="Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain...; Region: HMA; cd00371" /db_xref="CDD:238219" misc_feature order(394..402,409..411) /gene="LOC109676481" /note="metal-binding site [ion binding]" /db_xref="CDD:238219" misc_feature 718..894 /gene="LOC109676481" /note="Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain...; Region: HMA; cd00371" /db_xref="CDD:238219" misc_feature order(736..744,751..753) /gene="LOC109676481" /note="metal-binding site [ion binding]" /db_xref="CDD:238219" misc_feature 1024..1215 /gene="LOC109676481" /note="Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain...; Region: HMA; cd00371" /db_xref="CDD:238219" misc_feature order(1042..1050,1057..1059) /gene="LOC109676481" /note="metal-binding site [ion binding]" /db_xref="CDD:238219" misc_feature 1414..1602 /gene="LOC109676481" /note="Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain...; Region: HMA; cd00371" /db_xref="CDD:238219" misc_feature order(1429..1437,1444..1446) /gene="LOC109676481" /note="metal-binding site [ion binding]" /db_xref="CDD:238219" misc_feature 1639..1809 /gene="LOC109676481" /note="Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain...; Region: HMA; cd00371" /db_xref="CDD:238219" misc_feature order(1657..1665,1672..1674) /gene="LOC109676481" /note="metal-binding site [ion binding]" /db_xref="CDD:238219" ORIGIN
tctaaactttccttgcctgctcgtccctgggaaaaaccaatgaagcagagttttgcctttgacaatgttggctacgaagggagtctggatggcatatgctcctcaccaacgaccagcagcacaatcagcattctgggcatgacttgccagtcatgtgtcaagtccattgaggacaggatttctagtttgaaaggtgttgtgagcattaaggtttcactggaacaaggcagcgcagcagtgaaatatgtgccatccatcatgagcctgcaacagatttgccatcaagtcggggacatgggttttgaggccagcattgcagaaggaagggctgcctcctggccctcaaggtcctcatcagcccaggaggcagtggtcaagctccgggtagagggcatgacctgtcagtcctgtgtcagctccattgaaggcaaggtccggaaactgcaaggagtagtgagagtcaaagtctcccttagcaaccaagaggccgtcatcacttaccagccttatctcattcaacccgaagacctcagggaccatgtaactgacatgggatttgaagctgccatcaagaacaaaatggctcccttaagcctgggaccaattgacgtcagtcggttagaaagcactaacccaaagagattgtcagcttttgctaaccagaatttcaataactctgagacctcgaagtaccaaggaaaccatgtggccaccctccaactgggaatagagggaatgcattgtaaatcttgtgttttgaatattgaaggaaatataggccaactctcaggggttcaaaatattcaagtgtccttggagaacaaaactgcccaagtccagtatgacccttctcttatcacccctttgtccctaaagagggccattgaggcacttccacctgggaattttaaagtttctcttcctgatggagcagaagagagtgggccagagactggatcttctgagattccatcccatggctccccccagagaaaccagatgcaggatgcgtgcagaactgtggtgctgtccgtcactggcatgacctgtgcgtcctgtgtccagtccattgaaggcacagtctcccagcgggaaggggtgtggcaaatatcggtctctttggctgaagggactggaacgattctttatgatccctctgtaattacaccagaggaactccgagctgctgtagaagacatgggatttgaggcttcagtgattcctgaaaactattctaccagccatgttagaaatgacagtgctgggaattctatgctacaaactacaggcagcacacttgggtctgtgaaggaagtggctccctgtgtcagggtgctccctgagaaccacggtcctggccactcatcaaataccccaccacccaccagtacagtagccccacagaagtgctttttacaagtcaaaggcatgacctgtgcatcctgtgtgtctaacatagaaaggaatcttcagaaagaagctggtattctctctgtattggttgccttgatgtcgggaaaggcagaggtcaagtataatccagaggtcatccagccacccacaattgctcagctcatccaggacctgggctttgaggcaacagtcatggaagacaacgcaggctctgacggtgatatcgagctgattatcacggggatgacctgtgcttcctgtgttcacaacatagagtccagactcaccaggacaaatggcatcacctatgcctctgtagccctcgccaccagcaaagcccatgtgaagtttgatccagaaatcattggtccacgggatattgtgaaaattattgag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]