GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-18 14:07:44, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_018848223             360 bp    mRNA    linear   PLN 28-AUG-2017
DEFINITION  Isaria fumosorosea ARSEF 2679 hypothetical protein (ISF_04617),
            partial mRNA.
ACCESSION   XM_018848223
VERSION     XM_018848223.1
DBLINK      BioProject: PRJNA342686
            BioSample: SAMN04908328
KEYWORDS    RefSeq.
SOURCE      Cordyceps fumosorosea ARSEF 2679
  ORGANISM  Cordyceps fumosorosea ARSEF 2679
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Hypocreomycetidae; Hypocreales; Cordycipitaceae;
            Cordyceps.
REFERENCE   1  (bases 1 to 360)
  AUTHORS   Shang,Y., Xiao,G., Zheng,P., Cen,K., Zhan,S. and Wang,C.
  TITLE     Divergent and convergent evolution of fungal pathogenicity
  JOURNAL   Genome Biol Evol (2016) In press
   PUBMED   27071652
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 360)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (28-AUG-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 360)
  AUTHORS   Hu,X., Xiao,G., Shang,Y., Chen,P., Huang,W., Chen,Y., Xu,Y.-J. and
            Wang,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2013) Institute of Plant Phyiology and Ecology,
            Shanghai Institutes for Biological Sciences, 300 Fengling Road,
            Shanghai, Shanghai 200032, China
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_017387310).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..360
                     /organism="Cordyceps fumosorosea ARSEF 2679"
                     /mol_type="mRNA"
                     /strain="ARSEF 2679"
                     /host="Popillia japonica"
                     /db_xref="taxon:1081104"
                     /chromosome="Unknown"
                     /country="Portugal: Azores"
                     /collection_date="Oct-1988"
     gene            <1..>360
                     /locus_tag="ISF_04617"
                     /db_xref="GeneID:30020909"
     CDS             1..360
                     /locus_tag="ISF_04617"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018704557.1"
                     /db_xref="GeneID:30020909"
                     /translation="
MGCRDLGIYQDPRYVPQGEPQWDRRGLKPVPPRHNEHHPVPRPTPNPAPVPAPVPAPVQAVPEMPVPGPRPHPHPQAAPKTAKAHRPHQLNLDAWKRGYCGKRPVVVLPPCGYGNWSRP"
ORIGIN      
atgggctgtcgagacttgggcatctaccaggacccccgatacgttccccaaggtgagccgcagtgggaccgccgagggttgaagccagttccccctcgccataacgagcaccacccggtgccccgtcccactccgaaccccgctccggttcctgctccggttcctgccccggttcaagcagtgcccgagatgcccgtgccgggcccgagaccacatccccatcctcaggctgccccaaagacagccaaagcacatcgaccacatcaactgaatctggacgcttggaagcgaggatactgcggaaaacggcccgttgtggtgctgccgccctgcggctacggaaattggagccggccataa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]