2024-05-19 05:48:12, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_018847858 231 bp mRNA linear PLN 28-AUG-2017 DEFINITION Isaria fumosorosea ARSEF 2679 hypothetical protein (ISF_04252), partial mRNA. ACCESSION XM_018847858 VERSION XM_018847858.1 DBLINK BioProject: PRJNA342686 BioSample: SAMN04908328 KEYWORDS RefSeq. SOURCE Cordyceps fumosorosea ARSEF 2679 ORGANISM Cordyceps fumosorosea ARSEF 2679 Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Hypocreales; Cordycipitaceae; Cordyceps. REFERENCE 1 (bases 1 to 231) AUTHORS Shang,Y., Xiao,G., Zheng,P., Cen,K., Zhan,S. and Wang,C. TITLE Divergent and convergent evolution of fungal pathogenicity JOURNAL Genome Biol Evol (2016) In press PUBMED 27071652 REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 231) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (28-AUG-2017) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 231) AUTHORS Hu,X., Xiao,G., Shang,Y., Chen,P., Huang,W., Chen,Y., Xu,Y.-J. and Wang,C. TITLE Direct Submission JOURNAL Submitted (03-DEC-2013) Institute of Plant Phyiology and Ecology, Shanghai Institutes for Biological Sciences, 300 Fengling Road, Shanghai, Shanghai 200032, China COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_017387309). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..231 /organism="Cordyceps fumosorosea ARSEF 2679" /mol_type="mRNA" /strain="ARSEF 2679" /host="Popillia japonica" /db_xref="taxon:1081104" /chromosome="Unknown" /country="Portugal: Azores" /collection_date="Oct-1988" gene <1..>231 /locus_tag="ISF_04252" /db_xref="GeneID:30020544" CDS 1..231 /locus_tag="ISF_04252" /codon_start=1 /product="hypothetical protein" /protein_id="XP_018704814.1" /db_xref="GeneID:30020544" /translation="
MSSIADGAGTRGPPNRDAVEGKQDMGAKEPNWMPDRSEHPLLAIDSRFKHDPELQFLSWRVRIYRYLTLVQPLGDV"
ORIGIN
atgtcttctattgccgacggtgcaggtacccgcggtcctccgaaccgggacgctgtggagggcaagcaagacatgggcgccaaggagccgaactggatgcctgaccggtcggaacatccgctcctggctatagattcacgcttcaagcatgaccctgagctgcagtttttgtcatggcgagtccgcatctaccgctacctgaccttggtgcagcctctcggtgatgtctaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]