LOCUS       XM_018036375             357 bp    mRNA    linear   INV 17-OCT-2018
DEFINITION  PREDICTED: Ceratina calcarata fibrillin-1-like (LOC108632070),
            mRNA.
ACCESSION   XM_018036375
VERSION     XM_018036375.2
DBLINK      BioProject: PRJNA340002
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Ceratina calcarata
  ORGANISM  Ceratina calcarata
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
            Aculeata; Apoidea; Anthophila; Apidae; Ceratina; Zadontomerus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_017131016.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 17, 2018 this sequence version replaced XM_018036375.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Ceratina calcarata Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 6% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..357
                     /organism="Ceratina calcarata"
                     /mol_type="mRNA"
                     /isolate="Rehan_Ccalc_2016"
                     /host="Rhus typhina"
                     /db_xref="taxon:156304"
                     /chromosome="Unknown"
                     /sex="pooled male and female"
                     /tissue_type="whole body"
                     /country="USA: Durham, NH"
                     /collection_date="2014"
                     /collected_by="Sandra Rehan"
                     /identified_by="Sandra Rehan"
     gene            1..357
                     /gene="LOC108632070"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 95% coverage of the annotated
                     genomic feature by RNAseq alignments, including 8 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:108632070"
     CDS             109..357
                     /gene="LOC108632070"
                     /codon_start=1
                     /product="fibrillin-1-like"
                     /protein_id="XP_017891864.2"
                     /db_xref="GeneID:108632070"
                     /translation="

MGAAWGPHCEICPSKDSDNYNELCLDKGFSVDGQDIDECRTIPDLCKNGLCINTLGSYRCVCNKGYKADKTGTQCVGMHSTL"

     misc_feature    <109..180
                     /gene="LOC108632070"
                     /note="TB domain; Region: TB; pfam00683"
                     /db_xref="CDD:425818"
     misc_feature    211..303
                     /gene="LOC108632070"
                     /note="Calcium-binding EGF domain; Region: EGF_CA;
                     pfam07645"
                     /db_xref="CDD:429571"
     misc_feature    order(211..213,220..222,265..267)
                     /gene="LOC108632070"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
ORIGIN      

tttgcagatcgcagagtcggttattgcttcttgcaaacgatcggtggccgatgcactgcgagaacttccgatctaaagacagttactaaagcggattgctgttgcacaatgggcgcagcctggggaccacactgcgagatttgcccttcgaaagactcggacaattacaatgaactttgcttagacaaaggtttctccgtggatggacaagacatcgacgagtgcagaacaattcccgacttgtgtaaaaatgggttgtgcatcaataccctcggttcttatcgatgcgtctgtaacaagggctacaaggctgataaaactgggacccaatgcgtcggtatgcattcgactttataa

//