LOCUS       XM_017837101            1394 bp    mRNA    linear   VRT 11-AUG-2016
DEFINITION  PREDICTED: Lepidothrix coronata homeobox B8 (HOXB8), transcript
            variant X2, mRNA.
ACCESSION   XM_017837101
VERSION     XM_017837101.1
DBLINK      BioProject: PRJNA338288
KEYWORDS    RefSeq.
SOURCE      Lepidothrix coronata (blue-crowned manakin)
  ORGANISM  Lepidothrix coronata
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Passeriformes; Pipridae;
            Lepidothrix.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_016690471.1) annotated using gene prediction method: Gnomon,
            supported by mRNA evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Lepidothrix coronata Annotation
                                           Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1394
                     /organism="Lepidothrix coronata"
                     /mol_type="mRNA"
                     /isolate="B3197"
                     /specimen_voucher="LSUMZ:110521"
                     /db_xref="taxon:321398"
                     /chromosome="Unknown"
                     /sex="male"
                     /dev_stage="adult"
                     /country="Peru: Loreto Department, 1.5 km S Libertad, S.
                     bank Rio Napo, 80 km N Iquitos"
     gene            1..1394
                     /gene="HOXB8"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 mRNAs, 8 Proteins, and 100%
                     coverage of the annotated genomic feature by RNAseq
                     alignments, including 1 sample with support for all
                     annotated introns"
                     /db_xref="GeneID:108508358"
     CDS             45..770
                     /gene="HOXB8"
                     /codon_start=1
                     /product="homeobox protein Hox-B8 isoform X2"
                     /protein_id="XP_017692590.1"
                     /db_xref="GeneID:108508358"
                     /translation="

MSSYFVNSLFSKYKTGDSLRPNYYDCGFAQDLGGRPTVVYGPSTGGTFQHPTQIQEFYHGASSLSSSPYQQNPCAVACHGDPGNFYGYDPLQRQSLFSAQESDLVQYTDCKLAASGLGEEAESSEQSPSPTQLFPWMRPQAAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKCEQEELEKQKMERAQEVDEEGEAQKADKK"

     misc_feature    order(477..491,495..497,546..548,564..566,603..605,
                     609..614,621..626,630..638,642..647)
                     /gene="HOXB8"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(483..485,492..494,612..614,621..626,633..635)
                     /gene="HOXB8"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    486..644
                     /gene="HOXB8"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
ORIGIN      

cttccttcctcctccaaacccgaccgtctcttatttaaattaaaatgagctcttatttcgtcaactcactcttctccaagtacaaaaccggggactccctgcgccccaactactatgactgtgggttcgctcaggatctcgggggcagacccaccgtggtgtacggccccagcacggggggcaccttccagcaccccacccaaatccaggagttctaccacggagcgtcctcgctctccagctccccttaccaacagaatccctgcgccgtggcgtgccatggggaccccggcaacttctatggctacgaccccttgcaaaggcagagcctcttcagcgcccaggagtcggacttggtgcagtacacggactgcaagctcgcggccagcggcctcggggaggaggcggagagctccgagcaaagcccttctccgacccagcttttcccttggatgcgaccgcaagccgctggacggaggagggggaggcaaacctacagccgctaccagacgctggaactggagaaggaatttctatttaatccctacctgacccgcaaacggaggatcgaggtctcgcatgccctgggattgacagaaaggcaggtcaaaatctggttccagaacaggaggatgaaatggaaaaaggaaaacaacaaagacaagtttcccagcagcaaatgcgagcaggaagaactggaaaaacagaaaatggaaagagcccaggaggtggacgaggaaggggaagcacagaaggcggacaagaaataaaaggatttttaaggactgaaaggcaagcgctgctggggtggcagagcccccgagccccacgttaatggcagttaatgtaagggaggggtggggaaaaaaaaacaacaatgcatagaaaagagaaaggaaaaaaaaacccttttattgctgtaaaacaatatagctgtaagcaccactttcctgattatcctttgatacaatgaacagtatgcaaaagtgatcgggagctctctcctgccttttgccagttattaactagtggtagtgtaacgcaatagcttatgtaaaacatgactgtgaaatcttctctctctctctctctgtccttctctctgtctctctctcttctttcctggggggtgggttggttaacgtagctttcaatgctagaggagttacgtgaaattacgttcgtgcactttttttttttttttgaaatttgatttttcttttccttttccacctttttggttgtggtttatctgtatgtgccggaggtagctactgaaacaaacatcccaacaacatgaaactgcctatttatgctctagttatctctctctttctctctctcttcctctctttgctttccctgctgttcttttccttggttcggtctttttt

//