GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-17 08:31:10, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_016624828             741 bp    mRNA    linear   PLN 03-MAY-2016
DEFINITION  PREDICTED: Nicotiana tabacum uncharacterized LOC107801497
            (LOC107801497), transcript variant X1, mRNA.
ACCESSION   XM_016624828
VERSION     XM_016624828.1
DBLINK      BioProject: PRJNA319578
KEYWORDS    RefSeq.
SOURCE      Nicotiana tabacum (common tobacco)
  ORGANISM  Nicotiana tabacum
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; asterids; lamiids; Solanales; Solanaceae;
            Nicotianoideae; Nicotianeae; Nicotiana.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_015934184.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Nicotiana tabacum Annotation Release
                                           100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..741
                     /organism="Nicotiana tabacum"
                     /mol_type="mRNA"
                     /cultivar="TN90"
                     /db_xref="taxon:4097"
                     /chromosome="Unknown"
     gene            1..741
                     /gene="LOC107801497"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 7 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:107801497"
     CDS             252..599
                     /gene="LOC107801497"
                     /codon_start=1
                     /product="uncharacterized protein LOC107801497"
                     /protein_id="XP_016480314.1"
                     /db_xref="GeneID:107801497"
                     /translation="
MAFTNKQYLISLMILMVALQVQYICSDCLLLSGHSHGKTATQHSRKLLYMLKEKETEPITVTGSEITKQGHGYGKTISTGNNGKNNKLELGVELREAPASPDPLHHHGNKPGIMP"
ORIGIN      
gttaataatgcgtatctgatcttcttcttctctctgcaactatagcagttagctgctaatcatcatattctttacctctacttcttcagatacatggctgctctgtctaatcatgcatattagtgtttctgaaacgctaaagctcctctataaattgcgatcagtattccgatatttacttcatctagaaaattaaattagtatttcttctgtttcatatttgtgtaagtggagtaaaaactttaattcacatggccttcactaacaagcagtatctaatttctttgatgatattaatggtagccttgcaagtgcaatatatatgctcagactgtttattgctaagtggacactcacatggaaaaaccgctacgcaacacagcagaaagttgctttacatgttgaaggagaaagagacagaaccaattactgtaactggaagtgaaattactaaacaaggacatggatatggaaaaacaataagcacagggaataatgggaagaacaataagttggaattaggtgtggaattaagagaagcacctgcgagtccagaccctttgcaccatcatgggaataaacctgggattatgccatagctgacactgcttactttacttctactactgtaatatttacttctgcacacttatcggcttgtttagttttctttttatttttcctttcttttttgggtctgccctttcaatgaggggttatagttctaagacaaatatgtaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]