2024-05-17 08:31:10, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_016624828 741 bp mRNA linear PLN 03-MAY-2016 DEFINITION PREDICTED: Nicotiana tabacum uncharacterized LOC107801497 (LOC107801497), transcript variant X1, mRNA. ACCESSION XM_016624828 VERSION XM_016624828.1 DBLINK BioProject: PRJNA319578 KEYWORDS RefSeq. SOURCE Nicotiana tabacum (common tobacco) ORGANISM Nicotiana tabacum Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_015934184.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Nicotiana tabacum Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..741 /organism="Nicotiana tabacum" /mol_type="mRNA" /cultivar="TN90" /db_xref="taxon:4097" /chromosome="Unknown" gene 1..741 /gene="LOC107801497" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 7 samples with support for all annotated introns" /db_xref="GeneID:107801497" CDS 252..599 /gene="LOC107801497" /codon_start=1 /product="uncharacterized protein LOC107801497" /protein_id="XP_016480314.1" /db_xref="GeneID:107801497" /translation="
MAFTNKQYLISLMILMVALQVQYICSDCLLLSGHSHGKTATQHSRKLLYMLKEKETEPITVTGSEITKQGHGYGKTISTGNNGKNNKLELGVELREAPASPDPLHHHGNKPGIMP"
ORIGIN
gttaataatgcgtatctgatcttcttcttctctctgcaactatagcagttagctgctaatcatcatattctttacctctacttcttcagatacatggctgctctgtctaatcatgcatattagtgtttctgaaacgctaaagctcctctataaattgcgatcagtattccgatatttacttcatctagaaaattaaattagtatttcttctgtttcatatttgtgtaagtggagtaaaaactttaattcacatggccttcactaacaagcagtatctaatttctttgatgatattaatggtagccttgcaagtgcaatatatatgctcagactgtttattgctaagtggacactcacatggaaaaaccgctacgcaacacagcagaaagttgctttacatgttgaaggagaaagagacagaaccaattactgtaactggaagtgaaattactaaacaaggacatggatatggaaaaacaataagcacagggaataatgggaagaacaataagttggaattaggtgtggaattaagagaagcacctgcgagtccagaccctttgcaccatcatgggaataaacctgggattatgccatagctgacactgcttactttacttctactactgtaatatttacttctgcacacttatcggcttgtttagttttctttttatttttcctttcttttttgggtctgccctttcaatgaggggttatagttctaagacaaatatgtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]