2024-05-19 09:06:50, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_014820060 5674 bp mRNA linear INV 01-DEC-2015 DEFINITION PREDICTED: Priapulus caudatus copper-transporting ATPase 1-like (LOC106815582), mRNA. ACCESSION XM_014820060 VERSION XM_014820060.1 DBLINK BioProject: PRJNA303167 KEYWORDS RefSeq; corrected model. SOURCE Priapulus caudatus ORGANISM Priapulus caudatus Eukaryota; Metazoa; Ecdysozoa; Scalidophora; Priapulida; Priapulimorpha; Priapulimorphida; Priapulidae; Priapulus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_014577090.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Priapulus caudatus Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 6.5 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## frameshifts :: corrected 2 indels internal stop codons :: corrected 2 genomic stop codons ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-247 AXZU02003241.1 2097-2343 c 248-436 AXZU02003240.1 16228-16416 c 437-652 AXZU02003240.1 9021-9236 c 653-778 AXZU02003240.1 7226-7351 c 779-1382 AXZU02003240.1 5484-6087 c 1383-1529 AXZU02003240.1 4726-4872 c 1530-1600 AXZU02003240.1 4386-4456 c 1601-1721 AXZU02003240.1 3092-3212 c 1722-1885 AXZU02003240.1 2496-2659 c 1886-2047 AXZU02003240.1 1872-2033 c 2048-2130 AXZU02003240.1 1448-1530 c 2131-2287 AXZU02003239.1 18415-18571 c 2288-2518 AXZU02003239.1 17961-18191 c 2519-2659 AXZU02003239.1 17310-17450 c 2660-2776 AXZU02003239.1 16951-17067 c 2777-3037 AXZU02003239.1 16368-16628 c 3038-3229 AXZU02003239.1 15921-16112 c 3230-3236 AXZU02003239.1 13843-13849 c 3237-3280 AXZU02003239.1 10670-10713 c 3281-3391 AXZU02003239.1 10558-10668 c 3392-3420 AXZU02003239.1 10528-10556 c 3421-3542 AXZU02003239.1 10011-10132 c 3543-3773 AXZU02003239.1 7859-8089 c 3774-3916 AXZU02003239.1 7124-7266 c 3917-4120 AXZU02003239.1 6661-6864 c 4121-4238 AXZU02003239.1 6329-6446 c 4239-4341 AXZU02003239.1 5801-5903 c 4342-5674 AXZU02003239.1 4125-5457 c FEATURES Location/Qualifiers source 1..5674 /organism="Priapulus caudatus" /mol_type="mRNA" /isolation_source="mud" /db_xref="taxon:37621" /chromosome="Unknown" /sex="male" /country="Sweden: Gulmarsfjord" /lat_lon="58.270 N 11.453 E" gene 1..5674 /gene="LOC106815582" /note="The sequence of the model RefSeq transcript was modified relative to its source genomic sequence to represent the inferred CDS: deleted 2 bases in 2 codons; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 Proteins, and 92% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:106815582" CDS 287..4645 /gene="LOC106815582" /note="The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 2 bases in 2 codons; substituted 2 bases at 2 genomic stop codons" /codon_start=1 /transl_except=(pos:3314..3316,aa:OTHER) /transl_except=(pos:3554..3556,aa:OTHER) /product="LOW QUALITY PROTEIN: copper-transporting ATPase 1-like" /protein_id="XP_014675546.1" /db_xref="GeneID:106815582" /translation="
MENISKHKEFANHSTNGNVAVISVKGMTCQSCVNTIEENIGKLDGIYEIKVSLGNKEAVVRFDESMTSAMEITDGIENMGFEAELECHLVRRVIAVEGMTCQSCVQTIQHKVVALQGVHSVQVSLETKIATVTYDAKITTTDAVMTAIDETGFIASLIQSKLEQSHVQVRVEGMTCQSCVNSIQDVIGKMPGVTSIVVSLSKKLAFVDHIPSVVSADDLCSAINDMGFDADLASAPPTDTTAVATVETTGDATCFVMIEGMTCQSCVKNIEGHISSVSGVRNISVSLKHKCATVMYDSGAISAAKVTDMIDDMGFIATLSDAPIVAPPGVKTQDVSHLNVPTGDVETYMLEVTGMTCKSCVRKIEERVREEEGVISVAVSLQEEQAIVKLNPHVTSIGNVRMTINQMGFMASLPGSLQIARSVSFQKLPLVDRKEVKQQNGGTVEVSLEDIEKCHLQVTGMTCASCVASIEKNLKKMEGIHDVLVALMASKAEVKYDPSYVLPQQIANHVIDLGFGCEVLEEGSPGEETIELLIRGMTCASCIHTIESRVAKVNGVNSAAVSLATSIGVFKFNPEVTGPRNVINAIEDSGYSAELVEKSKKSNIASLEHKRAIAQWRTSFFINLCFGLPTFIVMFYYMFSPYKEHIEVFAGLSLENLLLFCFCTPVQFIGGRHFYVQAMKALKHRSTNMDVLIMMATSIAYIYSIIVVAIAIVQGSKSPMTFFDAPPMLLVFISLGRWLEYIAKGKTSEAITKLMSLQATEAVLVEQDADGNVMSEKRINVELVQRGDILKVMPGEKVPVDARVIEGSSMADESLVTGEAMPVLKKPGSQVIGGSINQNGTLLIRATHVGTDTALAQIVRLVEEAQTSKAPIQALADKIAGFFVPMVIIASSLTCIVWIIIGHRNIAAIDPDFIPPEEGGSFSKTSITVEFAFRMAITVLAIACPCALGLATPTAVMVGTGVGAQQGILIKGGEPLETAHKLQCGAIVFDKTGTITHAVPHVTRVGFCSXRSECAASTRCCGGARTAEASSEHPIASAIRQIVKEWLRTDRMGKCTDFQAVPGCGLSASVSNVREPMLGRHRQGTNNRVXNQKVLKSQSVCNSHHCFPVVLVEGTPASKEYKVLIGNREWMNRNGLVVGEEVEARMSEHEILGQTAVLVAIDGVLVSMVAVADTVKAEAHLAVYTLKKSGLHVILLTGDNRKTAKAIAMQVGITKVFAEVLPSHKVAKIKQLQAKGMKVAMVGDGVNDSPALAQADVGIAIASGTDVAVEAADMVLIRNDLLDTVAAIDLSHKTVWRIRLNFLFASIYNIFGIPIAAGVLKPIGFSLQPWMAAAAMAASSVSVLCSSLLLKMYRKPVRMTLETDDYLNHLRMEALMLVANGDNISVHRGIDDDLPDDRGQRSSLKSSISEKLSQIGSKVYRLSQGGVQQRGLNQGLLSSGSSDGDDPYISRL"
misc_feature 347..538 /gene="LOC106815582" /note="Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain...; Region: HMA; cd00371" /db_xref="CDD:238219" misc_feature order(365..373,380..382) /gene="LOC106815582" /note="metal-binding site [ion binding]" /db_xref="CDD:238219" misc_feature 563..754 /gene="LOC106815582" /note="Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain...; Region: HMA; cd00371" /db_xref="CDD:238219" misc_feature order(581..589,596..598) /gene="LOC106815582" /note="metal-binding site [ion binding]" /db_xref="CDD:238219" misc_feature 788..976 /gene="LOC106815582" /note="Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain...; Region: HMA; cd00371" /db_xref="CDD:238219" misc_feature order(806..814,821..823) /gene="LOC106815582" /note="metal-binding site [ion binding]" /db_xref="CDD:238219" misc_feature 1052..1240 /gene="LOC106815582" /note="Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain...; Region: HMA; cd00371" /db_xref="CDD:238219" misc_feature order(1067..1075,1082..1084) /gene="LOC106815582" /note="metal-binding site [ion binding]" /db_xref="CDD:238219" misc_feature 1331..1522 /gene="LOC106815582" /note="Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain...; Region: HMA; cd00371" /db_xref="CDD:238219" misc_feature order(1349..1357,1364..1366) /gene="LOC106815582" /note="metal-binding site [ion binding]" /db_xref="CDD:238219" misc_feature 1652..1840 /gene="LOC106815582" /note="Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain...; Region: HMA; cd00371" /db_xref="CDD:238219" misc_feature order(1667..1675,1682..1684) /gene="LOC106815582" /note="metal-binding site [ion binding]" /db_xref="CDD:238219" misc_feature 1877..2068 /gene="LOC106815582" /note="Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain...; Region: HMA; cd00371" /db_xref="CDD:238219" misc_feature order(1895..1903,1910..1912) /gene="LOC106815582" /note="metal-binding site [ion binding]" /db_xref="CDD:238219" misc_feature 2144..4276 /gene="LOC106815582" /note="P-type heavy metal-transporting ATPase, similar to human copper-transporting ATPases, ATP7A and ATP7B; Region: P-type_ATPase_Cu-like; cd02094" /db_xref="CDD:319783" misc_feature order(3116..3118,3122..3124,4208..4210) /gene="LOC106815582" /note="putative Cu binding site [ion binding]; other site" /db_xref="CDD:319783" misc_feature order(3254..3262,3467..3469,3659..3667,3755..3757, 3875..3883,3941..3943,3950..3952,3959..3961,4016..4018, 4025..4027) /gene="LOC106815582" /note="putative ATP binding site [chemical binding]; other site" /db_xref="CDD:319783" ORIGIN
ggcactgttgttgatttctttggatctttgctgcaggttcctgtgtttgtgttacattattgtatctagttgtctgctagtactgtagtagtaaacttactgcaagtttttaaacttgtgagttgtgtacagctgaagcaatctgatctacgcaatgataaaaccataaatgataaaacttaaaaggtaaaacagctgtagacctacaacaagtgagtgtaaagagtactgcagtacaggtaccgagaaaccaagaggcagtgttattacttaatcatcagaaaccatggaaaatataagcaagcacaaggaattcgctaatcattcaactaatggcaatgtagcagtcatctctgtaaagggcatgacgtgtcagtcatgtgtcaacaccatcgaggaaaacattggaaaactcgatggcatatatgagatcaaggtgtcgcttggcaacaaggaggcagtggttagatttgatgagagcatgacatcggccatggaaatcactgatggcatagagaacatgggctttgaggcagaactagagtgccacctggtgagaagagtcatcgctgtcgagggcatgacatgtcagtcatgcgttcagacgatccaacacaaggtcgtagctctgcagggtgtgcattctgtgcaggtatccttggagaccaagatcgcaacagtaacatacgatgcgaagataacaactacggatgctgtcatgacagcgattgatgagacaggcttcattgcctctctcatacagtccaagctagagcagtcacatgtgcaagtccgagtggagggaatgacctgccagtcgtgtgtcaacagcatacaggatgtcattggcaagatgccaggtgtcaccagcattgtcgtgtctctcagcaagaagctggcatttgttgatcacattccatcggtcgtctcagcagacgacttatgcagcgcgatcaatgacatgggcttcgatgccgatcttgcatcagcgccacctactgacacaacagctgtagctacagtcgagaccaccggtgatgccacttgttttgtgatgatagagggcatgacctgtcagtcgtgcgtgaagaacattgaaggtcacatttcgtccgtgagtggagtgagaaatatctccgtctccctgaagcataagtgtgccaccgtgatgtacgacagtggcgccatctctgcagccaaagtcaccgacatgatcgacgacatgggtttcatagcaacgctgtcggacgccccgatcgtagcaccacctggtgtgaagacgcaggacgtgtcccatctgaacgtgccaacaggagatgtggaaacttatatgttggaggtaacaggcatgacgtgcaagtcctgtgtcaggaaaatagaagagcgtgtgagggaggaggagggcgtgatctcggtggcagtgtcgctacaggaggaacaagccattgttaagctgaatccgcatgtgacaagcattggcaatgtacgcatgaccatcaaccagatggggttcatggcttctctaccgggcagtcttcaaattgctcgcagcgtctcattccaaaagcttcccttagttgaccgcaaagaagtgaagcagcagaatggtggaacggtggaggtgtcattggaggatattgagaagtgccatctacaggtaacaggcatgacctgcgcctcctgtgtagcatccattgagaagaatctaaagaagatggagggtatacatgatgtacttgtggcattgatggcatccaaggcagaggtgaagtacgatccatcctacgttctcccccagcagatagctaaccatgtcatcgacctaggcttcggctgtgaggtgctggaagagggaagccctggtgaggaaacgatagagctgctgatcagagggatgacctgtgcatcgtgcatacacaccatagagtcacgtgttgctaaggtgaacggtgtcaactctgctgccgtctccctggcaacgtccatcggtgttttcaaattcaatccagaggttacgggaccacgcaatgttatcaacgcaatagaggattctggatattctgctgaactagtggagaaaagtaaaaagtcgaatattgcctcgctggaacacaagcgagccattgcacagtggagaacttcattctttattaacctttgcttcggactacccaccttcatcgttatgttctactacatgttctcaccatataaggaacacatcgaagtgttcgcaggcctctcactggaaaacctactgctgttctgcttctgcacacctgtgcagttcatcggcggaagacacttctacgttcaagcgatgaaggcactcaagcaccgcagcacgaacatggacgtgctgataatgatggcgaccagtattgcctacatctactcgatcatcgtcgtcgccatcgcgatagtgcaaggctccaaaagtccgatgacgttcttcgatgcaccgccaatgttactcgtcttcatctcgctcggacgctggctggagtacatcgccaagggtaagacatctgaagcaatcactaagctgatgtcgctgcaggcaacagaggccgttctggttgagcaagatgcagatggaaacgtcatgtcagagaaacgcataaacgttgagcttgtgcagcgtggagacattctcaaggtgatgccgggagagaaggtgccggtggatgctcgtgtgatcgaaggttcctcgatggctgatgaatcgctcgtgacaggagaagccatgcccgtgctgaagaaacctggatctcaggtcatcggtggatcgatcaatcaaaatggtacactgttgattcgcgcaacgcacgttggcacggacaccgcgctcgctcagatagtccgcctggtggaggaagcgcaaacctcgaaggcgccgatccaagctcttgctgacaagattgctggcttctttgttcccatggtgatcattgcgtcgagtctcacgtgcattgtgtggataatcataggacatcgcaacatcgccgccatcgatcctgacttcatacctcctgaggaaggaggcagcttcagtaagacttccattacggtagagtttgccttccgcatggccattacggtgctggcgatcgcgtgcccctgtgccctcggtcttgccacgcccactgcagtcatggtcggcaccggagtgggagcacagcagggcatactcatcaagggaggtgaaccgcttgagactgctcacaagctacagtgtggtgcgattgtatttgacaagactggaacgatcactcatgcggtgcctcacgtcacgcgtgtcggcttctgttcgtagcggagtgagtgtgcagcgtccaccaggtgctgcggtggtgctaggacagctgaagccagctcggagcatcctatcgcatcagccatccgccaaatagtgaaagagtggctgaggacggacaggatgggtaaatgcacagacttccaggcagtgccaggctgtggcctgagtgcaagtgtcagcaacgtacgggaaccgatgctaggcagacacagacagggcacgaataatagggtttaaaaccagaaggtgttaaagtcccagtcagtgtgtaattctcaccattgttttcctgtagttcttgtagaggggacgccggcgtctaaggagtacaaggtgctgattggaaacagggagtggatgaatcgtaatggactggttgttggggaggaggtggaagcacgcatgagcgaacacgaaatactcggtcagaccgctgtgctggtggccatagatggggtgctggtgtccatggttgctgttgctgacactgtcaaggccgaggctcatctagctgtgtacacactgaagaagagcggtcttcacgtcatactgctgacaggggacaatcgcaagactgcgaaagctattgcaatgcaggtcggaatcacaaaggtgtttgcagaggtgctgccctcacacaaggttgctaagataaagcagctgcaggcaaaaggcatgaaggtcgcgatggtaggagacggagtgaatgactcgccagctcttgcgcaggcagacgtcggcattgctatagcaagcggcacggatgtagccgtggaagctgcagacatggtgctcatacggaatgatctactggataccgtggctgccatcgatctctcgcataaaactgtctggaggattcgtctcaacttcttatttgctagcatctataacatttttggcatccctattgcagcaggtgttctgaaaccgattggattctctctgcagccgtggatggctgctgctgctatggctgcctctagcgtgtccgtcctctgttcgtcactgctgctaaaaatgtatagaaagccagtacgcatgaccctcgagacggacgactacctcaatcatctgcgcatggaagctctgatgctggttgctaacggcgacaacatctccgttcatcgtggcatcgacgacgaccttcctgacgaccgcggtcaacgctcaagcctcaagagcagcatatcagagaaactgagtcagatcggcagcaaggtgtaccgtctgtcccaaggaggtgtgcagcagcgaggcttgaaccaggggctgctgagcagtggtagtagtgacggggatgacccctacatcagccgcttgtaaacagggcagtagggaagggcagaaccaacgtataacagctcaaaagtatagtcaggaagaagagagcccaggtatatagcaccctcatataaacatggagaatgggagttgccacctatatagcactgccatataaacagggaggagggagagcctatctatagcactcccatataaacagggaggagggggagcctatctatagcactcccatataaacaggggaaaggggaagcccacatataccagccccttccccagataaacaagggaaaggggaagcccgcctataccagccccttccccatataaacaaggggaaggggaagcccacctaaaccagccccttccccatataaacagtgaagaggggaattctactatagcacccatatatgagaagaaatgagaagataacaaacctgtaacactcacgcgtagacaggaaaaacgggaggcaacgttattaccatagaaatgtgtcgggctttaactgatattcagctacgttaggaagacacatggatacagggcatgtgtaaatagatgaagaggatgtatatccgggttatttttaatgcaagtatagaataggggggacaacgttggaaatcactgtttttaatgtgttttattcttatattatacatgatagagaattatatatttgcgagtttatgatgtgcagtctgtatgaaacgactgattatcctaaaatacatccagcaggtgaatattcggtgaaacatcgtgtattgtgaagctgcttaattttagttctgacagcagcctgttgggtgtgaattgtatgtttttttaaatacaattactattgggccaggactcaagtgattttacgctaggacatgaaattcttaaatcaggcacagtgtagcctaatatgtcaataatttttaattgtttttgtattgcaatattactaactataaaaaactatttatgccgaaattgcttattttaaaatcactgtattctgtatattttaaaataattggatattttaatcaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]