LOCUS       XM_014787783             708 bp    mRNA    linear   MAM 27-NOV-2015
DEFINITION  PREDICTED: Ceratotherium simum simum leucine zipper protein 6
            (LOC106801840), mRNA.
ACCESSION   XM_014787783
VERSION     XM_014787783.1
DBLINK      BioProject: PRJNA191537
KEYWORDS    RefSeq; corrected model; includes ab initio.
SOURCE      Ceratotherium simum simum (southern white rhinoceros)
  ORGANISM  Ceratotherium simum simum
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Rhinocerotidae;
            Ceratotherium.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_004454187.1) annotated using gene prediction method: Gnomon,
            supported by mRNA evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Ceratotherium simum simum Annotation
                                           Release 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio   :: 7% of CDS bases
            frameshifts :: corrected 1 indel
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-15                AKZM01025643.1     204213-204227
            16-162              AKZM01025643.1     204315-204461
            163-708             AKZM01025643.1     204463-205008
FEATURES             Location/Qualifiers
     source          1..708
                     /organism="Ceratotherium simum simum"
                     /mol_type="mRNA"
                     /isolate="SDZICR_KB13650"
                     /sub_species="simum"
                     /db_xref="taxon:73337"
                     /chromosome="Unknown"
                     /sex="female"
                     /country="USA: San Diego Zoo, California"
     gene            1..708
                     /gene="LOC106801840"
                     /note="The sequence of the model RefSeq transcript was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: deleted 1 base in 1 codon;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 1 mRNA, 1 Protein, and 95% coverage of the
                     annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:106801840"
     CDS             1..276
                     /gene="LOC106801840"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: deleted 1 base in 1 codon"
                     /codon_start=1
                     /product="LOW QUALITY PROTEIN: leucine zipper protein 6"
                     /protein_id="XP_014643269.1"
                     /db_xref="GeneID:106801840"
                     /translation="

MSAFLFCIKSVILYALYQVKTGGLPVYISVLTNSPLQLQTGIYRLLVQIQHLWISSSSPMHSSPSEPSGARRRGRWVQCVWKLQASRPFFH"

ORIGIN      

atgtctgcttttttgttttgtattaagtcggtcattttgtatgcactatatcaagtaaaaacaggtggtttacctgtttacattagtgtactaacaaattcccccttgcagcttcagacaggtatctatagacttctagttcaaatacagcacctgtggatctcaagtagttctcctatgcatagctcaccttctgaacccagtggggcaagaaggagaggtaggtgggtgcagtgtgtatggaagctgcaagcaagtaggcccttttttcattgatttccttccctcaagtaatggattttaaatctgtatgtacctatttgattttttttttctgaaacttcaacttagctgctgttttcttccatgcaatattgtatcctcgattgtgtatagaagaagctggtgagagtgccctcctacataagcaattgcagtgtttttgcatgcaaaatttaaaaaatttaaattgtcctgattctattttgtaaatggaacaacaatcatatctttctaagcagtaatggaagaagactagtgctttgtgcattttgatatatttgagttcattttttccacaatgtaatacttttgacacaattgggtttctcatattatcctagttcatgtacatcagaatgctaaataatactgtgtttaagttttgtgttgcaagaacaaatggaataaacttgaattgtgctacag

//