LOCUS       XM_014274127             421 bp    mRNA    linear   VRT 15-OCT-2018
DEFINITION  PREDICTED: Zonotrichia albicollis sarcoplasmic/endoplasmic
            reticulum calcium ATPase 1-like (LOC102065920), mRNA.
ACCESSION   XM_014274127
VERSION     XM_014274127.2
DBLINK      BioProject: PRJNA217032
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Zonotrichia albicollis (white-throated sparrow)
  ORGANISM  Zonotrichia albicollis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Passeriformes; Passerellidae;
            Zonotrichia.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_005082042.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 15, 2018 this sequence version replaced XM_014274127.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Zonotrichia albicollis Annotation
                                           Release 102
            Annotation Version          :: 102
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 16% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..421
                     /organism="Zonotrichia albicollis"
                     /mol_type="mRNA"
                     /isolate="Tan morph"
                     /db_xref="taxon:44394"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="hematocrit"
     gene            1..421
                     /gene="LOC102065920"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 87% coverage of the annotated
                     genomic feature by RNAseq alignments, including 3 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:102065920"
     CDS             116..421
                     /gene="LOC102065920"
                     /codon_start=1
                     /product="sarcoplasmic/endoplasmic reticulum calcium
                     ATPase 1-like"
                     /protein_id="XP_014129602.1"
                     /db_xref="GeneID:102065920"
                     /translation="

MAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCKMFIMDKVEGDICSLSEFSITGSTYAPEGEVLKQDRPVKAGQFDGLLWVVGPHNRWWDLVMG"

     misc_feature    <116..>379
                     /gene="LOC102065920"
                     /note="Haloacid Dehalogenase-like Hydrolases; Region:
                     HAD_like; cl21460"
                     /db_xref="CDD:451251"
ORIGIN      

ctggatccgcggcgccatctactgctgcaagatcgccgtggccctggccgtggccgccatccctgaaggtctcccggccgtcatcaccacctgcctggccctggggacgcgccggatggccaagaagaacgcgattgtccgcagcctgccctcggtggagaccctgggctgcacctcggtcatctgctccgacaagaccggcacgctgaccaccaaccagatgtccgtctgcaagatgttcatcatggacaaggtggagggcgacatctgctccctgagcgagttctccatcaccggctccacctacgcgcccgagggagaagtgctgaagcaggaccgtccggtcaaggctggtcagttcgatggcctnttatgggtggtgggacctcataacaggtggtgggacctggttatgggatga

//