LOCUS       XM_014073378            1245 bp    mRNA    linear   VRT 11-SEP-2015
DEFINITION  PREDICTED: Thamnophis sirtalis metabotropic glutamate receptor
            1-like (LOC106554659), partial mRNA.
ACCESSION   XM_014073378
VERSION     XM_014073378.1
DBLINK      BioProject: PRJNA294278
KEYWORDS    RefSeq.
SOURCE      Thamnophis sirtalis
  ORGANISM  Thamnophis sirtalis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Lepidosauria; Squamata; Bifurcata; Unidentata; Episquamata;
            Toxicofera; Serpentes; Colubroidea; Colubridae; Natricinae;
            Thamnophis.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_013660458.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Thamnophis sirtalis Annotation
                                           Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..1245
                     /organism="Thamnophis sirtalis"
                     /mol_type="mRNA"
                     /isolate="EDBJR-23777"
                     /specimen_voucher="UTA:R:62823"
                     /db_xref="taxon:35019"
                     /chromosome="Unknown"
                     /sex="female"
                     /tissue_type="skeletal muscle"
                     /dev_stage="adult"
                     /country="USA: Coffin Butte Rd., Benton Co., Oregon"
                     /lat_lon="44.6992 N 123.2217 W"
                     /collection_date="Jun-2010"
                     /collected_by="Brian Gall"
     gene            1..>1245
                     /gene="LOC106554659"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 1 sample with support for all annotated introns"
                     /db_xref="GeneID:106554659"
     CDS             221..>1245
                     /gene="LOC106554659"
                     /codon_start=1
                     /product="metabotropic glutamate receptor 1-like"
                     /protein_id="XP_013928853.1"
                     /db_xref="GeneID:106554659"
                     /translation="

MLLTMCRQEDPMKLVTWIWMVSCNKMIGVLLVFFPAILLEMDFLPKNTGRKVLLSAATSQRSVARMDGDVIIGALFSVHHQPPAEKVPERKCGEIREQYGIQRVEAMFHTLDKINADPFLLPNITLGSEIRDSCWHSSVALEQSIEFIRDSLISIRDEKDALGRCLPDPLHHHQIRAKKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDILQARAMLDIVKRYNWTYVSAVHTEGNYGESGMEAFKELAAQEGLCIAHSDKIYSNAGEKSFEKLLQKLRERLPKARVVVCFCEGMTVRGILMAMRRMGVFRELLLIG"

     misc_feature    401..>1245
                     /gene="LOC106554659"
                     /note="Type 1 periplasmic binding fold superfamily;
                     Region: Periplasmic_Binding_Protein_type1; cl10011"
                     /db_xref="CDD:447875"
ORIGIN      

gaaatctgccttgcgatagaaaaacctaccgccgctgcttaattctgtaggcattcaaagccattccgagaagaatgggaagcagaagctgctgcaactggaattctctgctacaattcatgcctacagtgacttctgttgccctgttaagcttttgctttaagatcaccttggagattcttaagaagtaaaacagtgaagaaagtctgtggtcttctttatgcttttaaccatgtgtagacaggaagatcccatgaaactggtcacttggatctggatggtctcctgcaacaagatgataggagtcctgcttgtcttttttcctgctatcctcttggaaatggactttctccccaagaatactgggagaaaggttttgctttcagcagctacttcccaaagatcagtagccagaatggatggggatgtcattataggagccctcttttcagtccatcaccaacccccagctgagaaggtaccagaaaggaagtgtggtgagatccgagaacaatatggcatacagagagttgaggccatgtttcacactttggataaaataaacgcagacccatttctgctgcccaacatcactcttggcagtgaaattcgagattcctgctggcattcttcagtagccttggaacagagtattgaattcataagggattctttgatctctatccgagatgaaaaagatgccctgggtcgttgcctgccagatcctttacatcaccaccagatcagggctaaaaaacccattgctggtgtcattggtccaggttccagttctgtagccatccaagtgcaaaatctgcttcaactttttgatattcctcagattgcttattctgcaaccagtattgacctgagcgataaaactctgtacaaatatttcttgagggtggttccatctgatattctgcaagctagagccatgcttgacatcgtcaaacgttacaactggacatatgtatctgctgtgcatactgaaggaaactatggagagagtggcatggaagctttcaaggaactggctgcacaggaaggcctttgtattgcacattcagacaagatctacagcaatgcaggagaaaaaagctttgagaagctgttacagaagctccgggagaggttgccaaaggccagagttgtggtttgtttctgcgaagggatgactgtcaggggaatcctcatggctatgagacgaatgggagtatttagagagcttctacttattgggag

//