LOCUS       XM_013960938            1127 bp    mRNA    linear   VRT 09-SEP-2015
DEFINITION  PREDICTED: Apteryx australis mantelli ST6
            (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,
            3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5
            (ST6GALNAC5), mRNA.
ACCESSION   XM_013960938
VERSION     XM_013960938.1
DBLINK      BioProject: PRJNA294519
KEYWORDS    RefSeq.
SOURCE      Apteryx mantelli mantelli
  ORGANISM  Apteryx mantelli mantelli
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Palaeognathae; Apterygiformes; Apterygidae;
            Apteryx; Apteryx mantelli.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_014006747.1) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Apteryx australis mantelli
                                           Annotation Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1127
                     /organism="Apteryx mantelli mantelli"
                     /mol_type="mRNA"
                     /sub_species="mantelli"
                     /db_xref="taxon:202946"
                     /chromosome="Unknown"
     gene            1..1127
                     /gene="ST6GALNAC5"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 EST, 9 Proteins, and 90%
                     coverage of the annotated genomic feature by RNAseq
                     alignments, including 1 sample with support for all
                     annotated introns"
                     /db_xref="GeneID:106499452"
     CDS             13..753
                     /gene="ST6GALNAC5"
                     /codon_start=1
                     /product="alpha-N-acetylgalactosaminide
                     alpha-2,6-sialyltransferase 5"
                     /protein_id="XP_013816392.1"
                     /db_xref="GeneID:106499452"
                     /translation="

MHCKSCALVTSSGHLLGSKQGDKIDQTECVIRMNDAPTRGYGKDVGNKTSLRVIAHSSIQRILRNRNELLNMSHGAVFIFWGPSSYMRRDGKGLVYNNLQLMNQILPQLKAYMISRHKMLQFDDLFKRETGKDRKISNTWLSTGWFTMTIALELCDRINVYGMVPPDFCRDPNHLSVPYHYYEPLGPDECTMYISHERGRKGSHHRFITEKRVFENWARTFNIRFFQPDWKPEPLTVNHPEIKPVV"

     misc_feature    16..561
                     /gene="ST6GALNAC5"
                     /note="Glycosyltransferase family 29 (sialyltransferase);
                     Region: Glyco_transf_29; pfam00777"
                     /db_xref="CDD:425864"
ORIGIN      

cagcctttaaaaatgcactgcaagagttgtgcattggtaaccagttctggacaccttctgggaagtaaacaaggtgacaaaatcgaccagactgagtgtgtaatacgaatgaacgatgcacctactcgaggttatggaaaagatgtgggaaacaaaacaagccttcgagtcattgcacactctagtattcagaggattttacgaaatcgcaacgaactcttaaatatgagccatggagctgtatttatcttctggggtcctagcagctacatgaggagagatggaaaaggcttggtgtataataacctgcagctgatgaatcagatactgcctcaattaaaagcatatatgatttctcgccacaagatgcttcaatttgatgacctttttaaacgggaaaccgggaaagacaggaagatatccaacacttggcttagcacgggctggttcacaatgactatcgcattagagctctgtgacaggataaatgtttatggcatggtgccaccggatttctgcagggatcctaatcatctttcagtaccttatcattattacgaacctttgggacctgatgaatgcacaatgtacatttcccacgagcggggccgaaagggcagccatcatcgtttcatcacagagaaacgagtgtttgagaactgggcacggacattcaatattcgctttttccaaccagactggaaaccagaaccacttactgtaaatcaccctgagattaaaccggtggtctgagggatgaacacagaagactgcaatcacagtcacctactgtatcagctttcagggtgtttgttggaccttctgggacagcaagcagcctagagaagagtaacaggatttgcagatgagaactgcgacaacagtcaggaagtatgatggagtatatccagagtattttgtgtcaaactgtacattaaaccagtatatagccttttctggccatctgacttcctgtatgtgtatgtaatttgtgaaaagcaacttgagtatcattaatgggatggttaattcattatgttttttttaagtacaatgccactgaattttcatagtgaaaacttacagtacttatttaatgcaggtttttatgcaacctaggccagtat

//