2024-05-17 06:33:06, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_013780311 317 bp mRNA linear PLN 25-AUG-2015 DEFINITION PREDICTED: Brassica oleracea var. oleracea protein CLAVATA 3 (LOC106341577), mRNA. ACCESSION XM_013780311 VERSION XM_013780311.1 DBLINK BioProject: PRJNA293438 KEYWORDS RefSeq. SOURCE Brassica oleracea var. oleracea ORGANISM Brassica oleracea var. oleracea Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_013617409.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Brassica oleracea Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 6.4 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..317 /organism="Brassica oleracea var. oleracea" /mol_type="mRNA" /variety="oleracea" /cultivar="TO1000" /db_xref="taxon:109376" /chromosome="C4" /country="Canada" /lat_lon="52.1333 N 106.6833 W" /collection_date="31-Aug-2009" gene 1..317 /gene="LOC106341577" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins, and 71% coverage of the annotated genomic feature by RNAseq alignments, including 4 samples with support for all annotated introns" /db_xref="GeneID:106341577" CDS 33..317 /gene="LOC106341577" /codon_start=1 /product="protein CLAVATA 3" /protein_id="XP_013635765.1" /db_xref="GeneID:106341577" /translation="
MDSRTLVLLLLFCLMFLHGASDITHANANVHALPIRKMMVMKKDNEWGGANRIEEEKEKVFGLNEELRTVPSGPDPLHHHVNPPRKPRTDSHIP"
ORIGIN
tatcttttatatactctatctctctctacaaaatggattcgaggactctggtgctactgctgctcttttgcctcatgttcctgcatggtgcttctgatatcactcacgccaatgccaatgttcatgcacttcccattcgcaagatgatggtaatgaagaaggataatgaatggggaggagcaaatcgaattgaagaagagaaggagaaggttttcgggttaaatgaagagctaaggactgtcccttcaggacctgaccctttgcaccatcatgtgaaccccccaagaaagccacgaaccgactctcatatcccttaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]