2024-05-19 10:58:46, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_013115388 923 bp mRNA linear ROD 14-APR-2021 DEFINITION PREDICTED: Mesocricetus auratus copper chaperone for superoxide dismutase (Ccs), transcript variant X2, mRNA. ACCESSION XM_013115388 VERSION XM_013115388.3 DBLINK BioProject: PRJNA719779 KEYWORDS RefSeq. SOURCE Mesocricetus auratus (golden hamster) ORGANISM Mesocricetus auratus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Cricetidae; Cricetinae; Mesocricetus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024429182.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Apr 14, 2021 this sequence version replaced XM_013115388.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Mesocricetus auratus Annotation Release 103 Annotation Version :: 103 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..923 /organism="Mesocricetus auratus" /mol_type="mRNA" /isolate="SY011" /db_xref="taxon:10036" /chromosome="Unknown" /sex="female" /tissue_type="liver" /dev_stage="adult" gene 1..923 /gene="Ccs" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 181 samples with support for all annotated introns" /db_xref="GeneID:101842998" CDS 85..771 /gene="Ccs" /codon_start=1 /product="copper chaperone for superoxide dismutase isoform X2" /protein_id="XP_012970842.1" /db_xref="GeneID:101842998" /translation="
MASDSGDGGTMCALEFAVQMTCQSCVDAVHKTLKGVAENLGAAVAILEGSNTIQGVVRFLQLNSELCLIEGTIDGLEPGLHGFHVHQYGDLTKDCNSCGDHFNPDGTSHGGPQDTDRHLGDLGNVLADADGRATFRIEDKQLKVWDVIGRSLVVDEGEDDLGRGSHPLSKITGNSGKRLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGEGRKDSVQPPAHL"
misc_feature order(214..216,220..222,250..252,256..258,346..354, 526..531) /gene="Ccs" /note="E-class dimer interface [polypeptide binding]; other site" /db_xref="CDD:238186" misc_feature 241..636 /gene="Ccs" /note="Copper/zinc superoxide dismutase (SODC); Region: Sod_Cu; pfam00080" /db_xref="CDD:425456" misc_feature order(286..288,460..462) /gene="Ccs" /note="P-class dimer interface [polypeptide binding]; other site" /db_xref="CDD:238186" misc_feature order(334..336,340..342,385..387,436..438,445..447, 547..549) /gene="Ccs" /note="active site" /db_xref="CDD:238186" misc_feature order(334..336,340..342,385..387,547..549) /gene="Ccs" /note="Cu2+ binding site [ion binding]; other site" /db_xref="CDD:238186" misc_feature order(385..387,409..411,436..438,445..447) /gene="Ccs" /note="Zn2+ binding site [ion binding]; other site" /db_xref="CDD:238186" ORIGIN
ggctccgcccaccccacaagactgagcagtgttgctctctggaccctaactgttttgcggcccaggcggttgactatatccaggatggcttcggattccggggacggtggaaccatgtgtgcactggagtttgcagtgcagatgacctgtcagagctgcgtggacgcggtgcacaagaccctgaaaggggtggcagagaatctgggagcagcagtagccattctggagggctctaacaccatacagggcgtggtccgcttcctacagctgaactctgaactctgcctgattgagggaaccattgacggcctagagcccgggctgcatggattccatgttcatcagtatggggatctcacaaaggattgcaatagctgtggggaccattttaaccctgatggaacatctcatgggggccctcaggacactgatcggcacctgggagatctagggaatgtcctggctgatgctgatggtcgagccaccttccggatagaggataaacagctgaaggtgtgggatgtgattggccgcagcctggttgttgatgagggagaagatgacctgggccggggaagccatcccttatccaagatcacagggaactctgggaagaggttggcctgtggcatcattgcacgctctgcgggccttttccagaaccccaagcagatctgctcctgtgatggcctcactatctgggaggagcgaggccggcccattgctggtgaaggccgaaaggactcagtccagccccctgctcacctctgatcaaggcctcgggttattttgtccccctagctgaacatctactgcatagggaacagggggggctttgcttgtgtagacctaggcagactaagtacagggcaggtaggggttgctgcattcttagcaaattaaattgttattttcatatggta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]