LOCUS       XM_012642752             700 bp    mRNA    linear   PRI 01-JUN-2015
DEFINITION  PREDICTED: Propithecus coquereli leucine zipper protein 6 (LUZP6),
            mRNA.
ACCESSION   XM_012642752
VERSION     XM_012642752.1
DBLINK      BioProject: PRJNA281642
KEYWORDS    RefSeq; corrected model; includes ab initio.
SOURCE      Propithecus coquereli (Coquerel's sifaka)
  ORGANISM  Propithecus coquereli
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Strepsirrhini;
            Lemuriformes; Indriidae; Propithecus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_012143412.1) annotated using gene prediction method: Gnomon,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Propithecus coquereli Annotation
                                           Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.3
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio            :: 7% of CDS bases
            internal stop codons :: corrected 1 genomic stop codon
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..700
                     /organism="Propithecus coquereli"
                     /mol_type="mRNA"
                     /isolate="6110/MARCELLA"
                     /db_xref="taxon:379532"
                     /chromosome="Unknown"
                     /sex="female"
                     /tissue_type="kidney"
     gene            1..700
                     /gene="LUZP6"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 mRNA, 256 ESTs, 1 Protein, and
                     88% coverage of the annotated genomic feature by RNAseq
                     alignments"
                     /db_xref="GeneID:105808997"
     CDS             1..210
                     /gene="LUZP6"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: substituted 1 base at 1
                     genomic stop codon"
                     /codon_start=1
                     /transl_except=(pos:64..66,aa:OTHER)
                     /product="LOW QUALITY PROTEIN: leucine zipper protein 6"
                     /protein_id="XP_012498206.1"
                     /db_xref="GeneID:105808997"
                     /translation="

MVEKPFISYALYQVQTGNLPVXSSGLTNSPLQLPTGIYRLIVQVQHLNFPSSSSMHSSPFYTQLGMKER"

ORIGIN      

atggtagagaaaccattcatttcttatgcactatatcaagtacaaacaggtaatttacctgtttaaagtagtggactaacaaattctcccttgcagcttccgactggtatctacagacttatagttcaagtacagcacctgaatttcccaagtagttcttctatgcatagctcacctttctacacccagctgggcatgaaggagaggtaatacgtaggtgccgtttatggaagctgcgaacaagtgggccccctttattcactgatttcttgcctcagataatggatttcaaatctatatgtacctatttgatttttttttctaaaacttcaactgagctgctgttttcttccatgcaatattatatactcaattgtgtatagaagaagctggtgagagtgccctcctacataaataagcaattgcagtgttttgcatgcaaaatttaaaaaatttaaattgtcctgattctattttgtaaatggagaaacaatcatatctttctaagcagtaatggaggaagactagtgctttgtgcattttgatatatttgagttcatttttccataatgtcatatttttgacacaattgggtttctcataagtatcctagttcatgtacatcatccgaatgctaaataatactgtgtttaagttttgtgttgcaagaacaaatggaataaacttgaattgtgctaca

//