2024-05-19 04:49:50, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_012331278 246 bp mRNA linear PLN 20-APR-2015 DEFINITION Pseudozyma hubeiensis SY62 hypothetical protein partial mRNA. ACCESSION XM_012331278 VERSION XM_012331278.1 DBLINK BioProject: PRJNA264001 Sequence Read Archive: DRR006510 KEYWORDS RefSeq. SOURCE Pseudozyma hubeiensis SY62 ORGANISM Pseudozyma hubeiensis SY62 Eukaryota; Fungi; Dikarya; Basidiomycota; Ustilaginomycotina; Ustilaginomycetes; Ustilaginales; Ustilaginaceae; Pseudozyma. REFERENCE 1 AUTHORS Konishi,M., Hatada,Y. and Horiuchi,J. TITLE Draft Genome Sequence of the Basidiomycetous Yeast-Like Fungus Pseudozyma hubeiensis SY62, Which Produces an Abundant Amount of the Biosurfactant Mannosylerythritol Lipids JOURNAL Genome Announc 1 (4) (2013) PUBMED 23814110 REMARK DOI:10.1128/genomeA.00409-13 Publication Status: Online-Only REFERENCE 2 (bases 1 to 246) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (20-APR-2015) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 246) AUTHORS Konishi,M., Nagahama,T., Hatada,T. and Horiuchi,J. TITLE Direct Submission JOURNAL Submitted (25-APR-2013) Contact:Masaaki Konishi Kitami Institute of Technology; Koen-cho 165, Kitami, Hokkaido 090-8507, Japan COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_012133791). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..246 /organism="Pseudozyma hubeiensis SY62" /mol_type="mRNA" /strain="SY62" /db_xref="taxon:1305764" /note="scafford: PHSY9" gene <1..>246 /locus_tag="PHSY_000642" /db_xref="GeneID:24105947" CDS 1..246 /locus_tag="PHSY_000642" /codon_start=1 /product="hypothetical protein" /protein_id="XP_012186668.1" /db_xref="GeneID:24105947" /translation="
MGPSVKKAFRKKQLPKFCTSKVTFVASGELAEKTMKCRKTNTISESFSPSPTSEHPLFASFLDFIARCVRANVISDKPIVV"
ORIGIN
atgggtccgagtgtaaagaaggcttttcggaagaagcagttgccgaaattttgcacaagcaaggtcacgttcgttgctagcggcgagcttgccgagaagaccatgaaatgcaggaagaccaacaccatctcggaaagcttcagtccgagcccgacttccgagcatcctctcttcgcttccttcctcgacttcattgcccgatgtgtcagagcaaatgtcatctcggacaagcccatcgtagtgtga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]