GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-20 05:09:17, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_012000128             755 bp    mRNA    linear   PRI 30-MAR-2015
DEFINITION  PREDICTED: Mandrillus leucophaeus leucine zipper protein 6-like
            (LOC105553934), mRNA.
ACCESSION   XM_012000128
VERSION     XM_012000128.1
DBLINK      BioProject: PRJNA279492
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Mandrillus leucophaeus (drill)
  ORGANISM  Mandrillus leucophaeus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Cercopithecidae; Cercopithecinae; Mandrillus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_012106686.1) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Mandrillus leucophaeus Annotation
                                           Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 27% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..755
                     /organism="Mandrillus leucophaeus"
                     /mol_type="mRNA"
                     /isolate="KB7577"
                     /db_xref="taxon:9568"
                     /chromosome="Unknown"
                     /sex="female"
                     /tissue_type="heart"
     gene            1..755
                     /gene="LOC105553934"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 280 ESTs, 2 Proteins"
                     /db_xref="GeneID:105553934"
     CDS             1..243
                     /gene="LOC105553934"
                     /codon_start=1
                     /product="leucine zipper protein 6-like"
                     /protein_id="XP_011855518.1"
                     /db_xref="GeneID:105553934"
                     /translation="
MPLSDPSWMLITYCTKAITGFCIKSVISYALYQVQTGSLPVYSSVLTKSPLQLQTGIYRLIVQIQHLNIPSSSSTHSSPF"
ORIGIN      
atgcctctctcagacccatcttggatgctgattacttattgcaccaaagctatcactgggttttgtattaaatcagtcatttcatatgcactatatcaagtacaaacaggtagtttacctgtttatagtagtgtactaacaaagtctcccttgcagcttcagactggtatctataggcttatcgttcaaatacagcacttgaatatcccaagtagttcttctacgcatagctcacctttctaaacccagttaagcatggaagagaggtagtaggtaggtgcagtgtgtggaagctgcagacaagtaggccttttattcattgatttcttttcccaagtactggattttaaatctatatgtatctatttgatttttttcctaatatttcaattgagctgctgttttcttccatgcaatattgtatactcaattgtgtatagaagaagctggtgagagtgccctcctacataaataagcaattgcagtgttttgcatgcaaaatataaaaaatttaaattgtcctgattctattttgtaaatggagaaacaatcatatctttctaagcagtaatggaggaagactagtgctttgtgcattttgatatatttgagttcattttttccacaatgtcatacttttgacacaattgggtttctcataagtatcctagttcatgtacatccgaatgctaaataatactgtgtttaagttttgtgttgcaagaacaaatggaataaacttgaattgtgctaca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]