2024-05-05 15:56:30, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_011926459 718 bp mRNA linear PRI 30-MAR-2015 DEFINITION PREDICTED: Colobus angolensis palliatus claudin 17 (CLDN17), mRNA. ACCESSION XM_011926459 VERSION XM_011926459.1 DBLINK BioProject: PRJNA279495 KEYWORDS RefSeq. SOURCE Colobus angolensis palliatus ORGANISM Colobus angolensis palliatus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Cercopithecidae; Colobinae; Colobus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_012120598.1) annotated using gene prediction method: Gnomon, supported by mRNA evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Colobus angolensis palliatus Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 6.2 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..718 /organism="Colobus angolensis palliatus" /mol_type="mRNA" /isolate="OR3802" /sub_species="palliatus" /db_xref="taxon:336983" /chromosome="Unknown" /sex="female" /tissue_type="heart" gene 1..718 /gene="CLDN17" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 2 Proteins" /db_xref="GeneID:105500795" CDS 30..704 /gene="CLDN17" /codon_start=1 /product="claudin-17" /protein_id="XP_011781849.1" /db_xref="GeneID:105500795" /translation="
MAFYPLQIAGLVFGFLGMVGTLATTLLPQWRVSAFVGSNIIVFERLWEGLWMNCIQQARVRLQCKFYSSLLALPPVLETARALMCVAVALSLIALLIGICGMKQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPAVHIGQKRELGVALFLGWASAAVLFIGGGLLCGFCCCNRKKQRYRYPVPGHCVPHTDKRRNVTMPSNTSTSYV"
misc_feature 45..575 /gene="CLDN17" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN
aattggactagtcttcaaagtaaaaggcaatggcattttatcccttgcaaattgctgggctggtttttgggttccttggcatggtggggactcttgccacaacgcttctgcctcagtggagagtatcagcttttgttggcagcaacattattgtctttgagaggctctgggaagggctctggatgaactgcatccaacaagccagggtccggttgcaatgcaagttctatagttcattgttggctcttccgcctgtcctggaaacagcccgggcactcatgtgtgtggctgttgctctctccttgatcgccctacttattggcatctgtggcatgaagcaggtccagtgcacgggctctaatgagagggccaaagcataccttctgggaacttcaggagtcctcttcatcctgacgggcatcttcgttctgattccagtgagctggacagccaatataatcatcagagatttctacaacccagctgtccacataggtcagaaacgagagctgggagtagcacttttccttggctgggcaagcgctgctgtcctcttcattggagggggtctgctttgtgggttttgctgctgcaacagaaagaagcaaaggtacagatatccagtgcctggccactgtgtgccacacacagataagcgaagaaacgtgacaatgcctagtaatacctccaccagttatgtctaatgcctgcttttggc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]