GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-18 21:41:49, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_011412523             273 bp    mRNA    linear   PLN 29-DEC-2023
DEFINITION  Metarhizium robertsii ARSEF 23 Fungal transcriptional regulatory
            protein (MAA_11608), partial mRNA.
ACCESSION   XM_011412523
VERSION     XM_011412523.1
DBLINK      BioProject: PRJNA245140
            BioSample: SAMN02981260
KEYWORDS    RefSeq.
SOURCE      Metarhizium robertsii ARSEF 23
  ORGANISM  Metarhizium robertsii ARSEF 23
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Hypocreomycetidae; Hypocreales; Clavicipitaceae;
            Metarhizium.
REFERENCE   1  (bases 1 to 273)
  AUTHORS   Hu,X., Xiao,G., Zheng,P., Shang,Y., Su,Y., Zhang,X., Liu,X.,
            Zhan,S., St Leger,R.J. and Wang,C.
  TITLE     Trajectory and genomic determinants of fungal-pathogen speciation
            and host adaptation
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 111 (47), 16796-16801 (2014)
   PUBMED   25368161
REFERENCE   2  (bases 1 to 273)
  AUTHORS   Gao,Q., Jin,K., Ying,S.H., Zhang,Y., Xiao,G., Shang,Y., Duan,Z.,
            Hu,X., Xie,X.Q., Zhou,G., Peng,G., Luo,Z., Huang,W., Wang,B.,
            Fang,W., Wang,S., Zhong,Y., Ma,L.J., St Leger,R.J., Zhao,G.P.,
            Pei,Y., Feng,M.G., Xia,Y. and Wang,C.
  TITLE     Genome sequencing and comparative transcriptomics of the model
            entomopathogenic fungi Metarhizium anisopliae and M. acridum
  JOURNAL   PLoS Genet. 7 (1), E1001264 (2011)
   PUBMED   21253567
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 273)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (28-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 273)
  AUTHORS   Hu,X., Xiao,G., Shang,Y., Chen,P., Huang,W., Chen,Y., Xu,Y.-J. and
            Wang,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-DEC-2013) Institute of Plant Physiology and Ecology,
            Shanghai Institutes for Biological Sciences, 300 Fengling Road,
            Shanghai, Shanghai 200032, China
REFERENCE   5  (bases 1 to 273)
  AUTHORS   Gao,Q., Jin,K., Ying,S., Luo,Z., Xiao,G., Duan,Z., Xie,X., Zhou,G.,
            Peng,G., Zhang,Y., Shang,Y.F., Huang,W., Wang,B., Wang,S., Fang,W.,
            Ma,L.-J., Liu,X., St. Leger,R.J., Pei,Y., Feng,M., Xia,Y. and
            Wang,C.
  CONSRTM   Metarhizium genome sequencing Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (10-MAY-2010) Institute of Plant Physiology and Ecology,
            Shanghai Institutes for Biological Sciences, 300 Fenglin Road,
            Shanghai, Shanghai 200032, China
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_011942151).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..273
                     /organism="Metarhizium robertsii ARSEF 23"
                     /mol_type="mRNA"
                     /strain="ARSEF 23"
                     /host="Conoderus sp."
                     /db_xref="taxon:655844"
                     /chromosome="Unknown"
                     /country="USA: North Carolina"
                     /collection_date="1961"
     gene            <1..>273
                     /locus_tag="MAA_11608"
                     /db_xref="GeneID:23633056"
     CDS             1..273
                     /locus_tag="MAA_11608"
                     /codon_start=1
                     /product="Fungal transcriptional regulatory protein"
                     /protein_id="XP_011410825.1"
                     /db_xref="GeneID:23633056"
                     /translation="
MIALKSWKKSERVRWDGNKHSPEETAGLFGLGALSWLNPLSLAGYKKRLALEDLYRLDCNLASEHLQVNHPPVSTVCAVALGNVTVWPER"
     misc_feature    46..>174
                     /locus_tag="MAA_11608"
                     /note="ABC transporter C family member; Provisional;
                     Region: PLN03130"
                     /db_xref="CDD:215595"
ORIGIN      
atgattgctctcaagtcgtggaaaaagtctgaacgggtccgctgggacggaaataagcatagtcctgaggagacggctggcttgtttggtctcggtgccctttcatggcttaacccgctctcgttggcaggatacaagaagagattggccctagaggacttgtaccgcctcgattgcaacttggcatcagagcatctgcaggtcaatcacccgcctgtgtcaacagtctgcgcagtagccctgggaaacgttacggtctggccagagcgctga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]