2024-05-20 06:07:28, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_011328621 411 bp mRNA linear PLN 02-JAN-2024 DEFINITION Fusarium graminearum PH-1 uncharacterized protein (FGSG_13090), partial mRNA. ACCESSION XM_011328621 VERSION XM_011328621.1 DBLINK BioProject: PRJNA243 BioSample: SAMN02953593 KEYWORDS RefSeq. SOURCE Fusarium graminearum PH-1 (Gibberella zeae PH-1) ORGANISM Fusarium graminearum PH-1 Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Hypocreales; Nectriaceae; Fusarium. REFERENCE 1 (bases 1 to 411) AUTHORS Cuomo,C.A., Guldener,U., Xu,J.R., Trail,F., Turgeon,B.G., Di Pietro,A., Walton,J.D., Ma,L.J., Baker,S.E., Rep,M., Adam,G., Antoniw,J., Baldwin,T., Calvo,S., Chang,Y.L., Decaprio,D., Gale,L.R., Gnerre,S., Goswami,R.S., Hammond-Kosack,K., Harris,L.J., Hilburn,K., Kennell,J.C., Kroken,S., Magnuson,J.K., Mannhaupt,G., Mauceli,E., Mewes,H.W., Mitterbauer,R., Muehlbauer,G., Munsterkotter,M., Nelson,D., O'donnell,K., Ouellet,T., Qi,W., Quesneville,H., Roncero,M.I., Seong,K.Y., Tetko,I.V., Urban,M., Waalwijk,C., Ward,T.J., Yao,J., Birren,B.W. and Kistler,H.C. TITLE The Fusarium graminearum genome reveals a link between localized polymorphism and pathogen specialization JOURNAL Science 317 (5843), 1400-1402 (2007) PUBMED 17823352 REFERENCE 2 (bases 1 to 411) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (29-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 411) AUTHORS Birren,B., Lander,E., Galagan,J., Nusbaum,C., Devon,K., Ma,L.-J., Jaffe,D., Butler,J., Alvarez,P., Gnerre,S., Grabherr,M., Kleber,M., Mauceli,E., Brockman,W., MacCallum,I.A., Young,S., LaButti,K., DeCaprio,D., Crawford,M., Koehrsen,M., Engels,R., Montgomery,P., Pearson,M., Howarth,C., Larson,L., White,J., O'Leary,S., Kodira,C., Zeng,Q., Yandava,C., Alvarado,L., Kistler,C., Xu,J.-R. and Trail,F. CONSRTM The Broad Institute Genome Sequencing Platform TITLE Direct Submission JOURNAL Submitted (08-NOV-2008) Broad Institute of MIT and Harvard, 7 Cambridge Center, Cambridge, MA 02142, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_026477). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..411 /organism="Fusarium graminearum PH-1" /mol_type="mRNA" /strain="PH-1; NRRL 31084" /db_xref="taxon:229533" /chromosome="4" gene <1..>411 /locus_tag="FGSG_13090" /db_xref="GeneID:23559897" CDS 1..411 /locus_tag="FGSG_13090" /codon_start=1 /product="hypothetical protein" /protein_id="XP_011326923.1" /db_xref="GeneID:23559897" /translation="
MSHDGFCDSMQAGHAVLSGCFASAASLSGLVTEQQGNGSIFMTIPRNIVISIYIGCKNKWAALKTWTCCQVDEKWIRGSTATKSRRRPVGTGPQLEGYRTKTWTQTMNPDLDLGSRLIPEACVPGCRSGRITPATR"
ORIGIN
atgtctcatgatggattctgtgacagcatgcaggcaggacacgccgtactgtcgggttgcttcgcttcagccgcttcgctttcaggtctggtgaccgaacagcaaggtaatggctccatattcatgaccatcccacgaaacatcgttatcagtatctatatcggttgcaagaacaaatgggcagccttaaagacttggacgtgttgtcaagtcgatgagaaatggattcgggggtcgactgccaccaaatctcgccgccggccggttgggactggtccccagctggaaggataccgtaccaagacctggacccagaccatgaacccggacctggacctgggctcgaggctaataccggaagcgtgcgttcctggttgtaggtcaggtcggatcactcccgcgacgcgatga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]