LOCUS       XM_011305731             812 bp    mRNA    linear   INV 10-FEB-2015
DEFINITION  PREDICTED: Fopius arisanus glycine-rich RNA-binding protein 3,
            mitochondrial-like (LOC105267100), mRNA.
ACCESSION   XM_011305731
VERSION     XM_011305731.1
DBLINK      BioProject: PRJNA274979
KEYWORDS    RefSeq.
SOURCE      Fopius arisanus
  ORGANISM  Fopius arisanus
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
            Ichneumonoidea; Braconidae; Opiinae; Fopius.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_011887783.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Fopius arisanus Annotation Release
                                           100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..812
                     /organism="Fopius arisanus"
                     /mol_type="mRNA"
                     /strain="USDA-PBARC FA_bdor"
                     /isolation_source="library from a single individual (USDA
                     ID 24.2), library from a pool of individuals that are full
                     siblings of the first individual (USDA ID 24pool), library
                     from a pool of individual that are half siblings of the
                     first individual (USDA ID 12pool)"
                     /db_xref="taxon:64838"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole organism"
     gene            1..812
                     /gene="LOC105267100"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 4 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:105267100"
     CDS             72..617
                     /gene="LOC105267100"
                     /codon_start=1
                     /product="glycine-rich RNA-binding protein 3,
                     mitochondrial-like"
                     /protein_id="XP_011304033.1"
                     /db_xref="GeneID:105267100"
                     /translation="

MAKLLAVVILLIVTCASAYPTIQSDEQDRDFKVRVARSPGPDPLHHHHHYGGYDGYGRYGEHGGYGGYGGYGGYGGYGGYGDNDGGYGSQRYNGYGNQRFNGYGNQGYNGYGNQGYNGYGNQGYNGYGNQGYGNQGYNRYPQSGNSQSAANANSGSFNTPFGSGSFASANANSRNDNGEIY"

ORIGIN      

tctgaacgtcagttcttcgtttacgataggacagtcgagtcgtgagatctcaagctcaagtgaaaaaaaaaatggctaaactccttgcagttgtcatccttttgattgtgacatgtgcatcggcgtatccgaccattcaatccgatgaacaagatagagatttcaaggtgagagtggctagatcgccaggtcctgatccacttcatcaccatcatcattacggcggatatgatgggtatggaagatatggagaacatggaggatatggaggatatggaggatatggaggatacggaggatacggaggatatggtgataacgatggaggctatggatcccaaagatacaatggctatggaaatcagagattcaatggctacggaaatcaaggatacaatggctacggaaatcagggatacaatggctacggaaatcagggatacaatggctacggaaatcagggatatggaaaccagggatacaacagatatccccagtctggaaactctcaatccgctgccaacgcaaattccggttccttcaacactccatttggcagtggatccttcgcctctgccaatgccaactccagaaacgacaacggagaaatctactgagaacgactcgccctgactgaagagctactgaataatcattcgttccttgaaaaacattttcaacacctgtgaatcgtctttaatttattaattttaatacaaccgcatgaattactcctgaattatttataagtgttcatatttttacttctgtgaatgaatctaggaaatataaaagttaggattttaggataa

//