GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-19 11:49:33, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_010832701             280 bp    mRNA    linear   MAM 31-DEC-2014
DEFINITION  PREDICTED: Bison bison bison plasma membrane calcium-transporting
            ATPase 3-like (LOC104983269), partial mRNA.
ACCESSION   XM_010832701
VERSION     XM_010832701.1
DBLINK      BioProject: PRJNA266339
KEYWORDS    RefSeq.
SOURCE      Bison bison bison
  ORGANISM  Bison bison bison
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Ruminantia;
            Pecora; Bovidae; Bovinae; Bison.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_011472491.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Bison bison bison Annotation Release
                                           100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..280
                     /organism="Bison bison bison"
                     /mol_type="mRNA"
                     /isolate="TAMUID 2011002044"
                     /sub_species="bison"
                     /db_xref="taxon:43346"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="blood"
     gene            <1..>280
                     /gene="LOC104983269"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 1 sample
                     with support for all annotated introns"
                     /db_xref="GeneID:104983269"
     CDS             <1..>280
                     /gene="LOC104983269"
                     /codon_start=1
                     /product="plasma membrane calcium-transporting ATPase
                     3-like"
                     /protein_id="XP_010831003.1"
                     /db_xref="GeneID:104983269"
                     /translation="
KMMRDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTHYKEVPAPSALTPKILDILVHAISINSAYTTKILPPEKEGALPRQV"
     misc_feature    <1..>135
                     /gene="LOC104983269"
                     /note="Haloacid Dehalogenase-like Hydrolases; Region:
                     HAD_like; cl21460"
                     /db_xref="CDD:451251"
     misc_feature    79..93
                     /gene="LOC104983269"
                     /note="HAD signature motif I; other site"
                     /db_xref="CDD:319763"
ORIGIN      
aaaatgatgagggacaacaacctggtccgccacctggatgcctgcgagaccatgggcaatgccacagccatctgttctgacaagacgggcacactcaccaccaaccgcatgaccgtggtgcagtcctaccttggggacacccactacaaagaggttccagcccccagtgccctgacccccaagatcctcgacatcctggtccatgccatctccatcaacagtgcctacaccaccaaaatactacctccagagaaggaaggcgccctcccacgccaagtgg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]