GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-20 04:08:31, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_010542827             361 bp    mRNA    linear   PLN 18-NOV-2016
DEFINITION  PREDICTED: Tarenaya hassleriana defensin-like protein 183
            (LOC104814662), mRNA.
ACCESSION   XM_010542827
VERSION     XM_010542827.1
DBLINK      BioProject: PRJNA268022
KEYWORDS    RefSeq.
SOURCE      Tarenaya hassleriana
  ORGANISM  Tarenaya hassleriana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; New World
            clade; Tarenaya.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_010965451.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Tarenaya hassleriana Annotation
                                           Release 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..361
                     /organism="Tarenaya hassleriana"
                     /mol_type="mRNA"
                     /db_xref="taxon:28532"
                     /chromosome="Unknown"
                     /tissue_type="seeding stem"
     gene            1..361
                     /gene="LOC104814662"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 6 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:104814662"
     CDS             13..252
                     /gene="LOC104814662"
                     /codon_start=1
                     /product="defensin-like protein 183"
                     /protein_id="XP_010541129.1"
                     /db_xref="GeneID:104814662"
                     /translation="
MAKVSSIFILFSLFLLFTGGLERVTCREAKDICTKGFGLCTKDCDINCCKNKCAGEILGGQGSCDSIANVVLCNCYYHC"
ORIGIN      
aaaaacctaaagatggccaaggtttcttcaatcttcatcctcttctccctcttcctccttttcacaggagggttggagagggtgacgtgtcgtgaggcgaaggatatatgcaccaaagggttcgggctttgcaccaaagactgcgacatcaactgttgcaagaacaaatgcgcaggtgagatcttaggtggtcagggcagctgcgactccatcgccaacgttgtcctctgcaattgctactaccattgttaagctctcattcaaatatatatttacggtgttatattccgtatataataagacgatgtttctcttgatgtttccaattatgtggttctcacaattatattatttaataaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]