2024-05-18 16:07:13, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_010540817 354 bp mRNA linear PLN 18-NOV-2016 DEFINITION PREDICTED: Tarenaya hassleriana root meristem growth factor 5 (LOC104813250), mRNA. ACCESSION XM_010540817 VERSION XM_010540817.1 DBLINK BioProject: PRJNA268022 KEYWORDS RefSeq; includes ab initio. SOURCE Tarenaya hassleriana ORGANISM Tarenaya hassleriana Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; New World clade; Tarenaya. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_010965372.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Tarenaya hassleriana Annotation Release 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.2 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..354 /organism="Tarenaya hassleriana" /mol_type="mRNA" /db_xref="taxon:28532" /chromosome="Unknown" /tissue_type="seeding stem" gene 1..354 /gene="LOC104813250" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:104813250" CDS 1..354 /gene="LOC104813250" /codon_start=1 /product="root meristem growth factor 5" /protein_id="XP_010539119.1" /db_xref="GeneID:104813250" /translation="
MSSVHAASFLVMFLFIHACDSRHVGIFDHVSIAGFRFQTQSKDLPKASSVRVTEKAGENHFKGSPVQDSIEEGSRIVQRKSMARVSQRVKHDHQPHPHPPEFYADYPKPSTRPPRHN"
ORIGIN
atgagctcggttcatgctgcttcgttccttgtcatgtttctattcatccatgcttgcgattctcgtcacgtcgggatcttcgatcatgtttccattgcaggtttcaggtttcagacacaatccaaggatctgcctaaggcttcttcggttagggttacagagaaagctggtgaaaaccatttcaaagggtcaccagttcaggactccatcgaagaaggctcgagaattgttcagagaaagagcatggctagggtttcacagagagtgaaacatgaccatcagccccatcctcatcctccagagttctacgccgactatccaaagccatccactcggcctcctcgccataactga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]