LOCUS       XM_010476231             279 bp    mRNA    linear   PLN 29-NOV-2016
DEFINITION  PREDICTED: Camelina sativa protein CLAVATA 3-like (LOC104754073),
            mRNA.
ACCESSION   XM_010476231
VERSION     XM_010476231.1
DBLINK      BioProject: PRJNA264159
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Camelina sativa (false flax)
  ORGANISM  Camelina sativa
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Camelina.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_025700.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Camelina sativa Annotation Release
                                           101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 6% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..279
                     /organism="Camelina sativa"
                     /mol_type="mRNA"
                     /cultivar="DH55"
                     /db_xref="taxon:90675"
                     /chromosome="16"
                     /tissue_type="leaf"
     gene            1..279
                     /gene="LOC104754073"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein, and 18% coverage of the
                     annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:104754073"
     CDS             1..279
                     /gene="LOC104754073"
                     /codon_start=1
                     /product="protein CLAVATA 3-like"
                     /protein_id="XP_010474533.1"
                     /db_xref="GeneID:104754073"
                     /translation="

MDSRSLVLLLLFCLLFLHDASDLTQAHDHALPTRKMMMMKKGSDWGGANGDKKEKQKGLGLHEELRTVPSGPDPLHHHVNPPRQPRNPSHLP"

ORIGIN      

atggattcgagaagtcttgtgctactgctactcttctgcctcttgttcctccatgatgcttctgatctcactcaagctcatgatcatgctcttcccacgcgcaagatgatgatgatgaagaaggggagtgactggggaggagcaaatggagacaaaaaagagaagcaaaaaggtttagggctacatgaagagcttagaaccgttccttcaggacctgaccctttgcaccatcatgtgaacccaccaagacagccaagaaacccctctcatctcccttga

//