LOCUS       XM_010185124             744 bp    mRNA    linear   VRT 06-NOV-2014
DEFINITION  PREDICTED: Mesitornis unicolor ST6
            (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,
            3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5
            (ST6GALNAC5), mRNA.
ACCESSION   XM_010185124
VERSION     XM_010185124.1
DBLINK      BioProject: PRJNA265381
KEYWORDS    RefSeq.
SOURCE      Mesitornis unicolor (brown roatelo)
  ORGANISM  Mesitornis unicolor
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Gruiformes; Mesitornithidae;
            Mesitornis.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_010186331.1) annotated using gene prediction method: Gnomon,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Mesitornis unicolor Annotation
                                           Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..744
                     /organism="Mesitornis unicolor"
                     /mol_type="mRNA"
                     /isolate="BGI_N332"
                     /db_xref="taxon:54374"
                     /chromosome="Unknown"
                     /sex="female"
                     /country="Madagascar"
     gene            1..744
                     /gene="ST6GALNAC5"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 mRNA, 1 EST, 4 Proteins"
                     /db_xref="GeneID:104541143"
     CDS             4..744
                     /gene="ST6GALNAC5"
                     /codon_start=1
                     /product="alpha-N-acetylgalactosaminide
                     alpha-2,6-sialyltransferase 5"
                     /protein_id="XP_010183426.1"
                     /db_xref="GeneID:104541143"
                     /translation="

MHCKSCALVTSSGHLLGSKQGDRIDETECVIRMNDAPTRGYGKDVGNKTSLRVIAHSSIQRILRNRNELLNMSHGAVFIFWGPSSYMRRDGKGLVYNNLQLMNQILPQLKVYMISRHKMLQFDDLFKRETGKDRKISNTWLSTGWFTMTIALELCDRINVYGMVPPDFCRDPNHLSVPYHYYEPLGPDECTMYISHERGRKGSHHRFITEKRVFENWARTFNIHFFQPDWKPEPLTVNHPQVKAVA"

     misc_feature    7..552
                     /gene="ST6GALNAC5"
                     /note="Glycosyltransferase family 29 (sialyltransferase);
                     Region: Glyco_transf_29; pfam00777"
                     /db_xref="CDD:425864"
ORIGIN      

aaaatgcactgcaagagttgtgctttggtaaccagctctggacacctcctgggaagtaaacaaggtgacagaatcgacgagacggagtgcgtaatacgaatgaatgatgcacccactcggggttatggaaaagatgttggcaacaaaacgagccttcgagtcattgcacactccagcattcagaggattttgcgaaatcgtaatgaactcttaaatatgagccacggtgctgtgttcatcttctggggtcctagcagctacatgaggagagatggtaaaggcctggtgtataataacctgcagctgatgaatcagatactgcctcaattaaaagtatatatgatttctcgccacaagatgctgcaatttgatgacctttttaaacgggaaaccgggaaagacaggaagatatccaacacttggcttagcacgggctggttcacaatgactatcgcgttagagctctgtgacaggataaatgtgtatggcatggtgccaccggatttctgcagggatcctaatcatctgtcagtaccttatcattattatgaacctctgggacccgacgagtgcacaatgtacatctcacacgagcggggacggaagggcagtcaccatcgcttcatcacagagaaacgagtgttcgagaactgggcacggacattcaacattcactttttccaaccggactggaaaccggagcccctcactgtaaaccacccccaggtcaaagcggtggcctga

//