2024-05-19 03:52:40, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_009981454 447 bp mRNA linear VRT 31-OCT-2014 DEFINITION PREDICTED: Tauraco erythrolophus potassium-transporting ATPase alpha chain 1-like (LOC104375169), partial mRNA. ACCESSION XM_009981454 VERSION XM_009981454.1 DBLINK BioProject: PRJNA265115 KEYWORDS RefSeq; includes ab initio. SOURCE Tauraco erythrolophus (red-crested turaco) ORGANISM Tauraco erythrolophus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Musophagiformes; Musophagidae; Tauraco. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_010054132.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Tauraco erythrolophus Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 6.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 7% of CDS bases ##RefSeq-Attributes-END## COMPLETENESS: incomplete on the 3' end. FEATURES Location/Qualifiers source 1..447 /organism="Tauraco erythrolophus" /mol_type="mRNA" /isolate="BGI_N340" /db_xref="taxon:121530" /chromosome="Unknown" /sex="male" /country="Greece" gene 1..>447 /gene="LOC104375169" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:104375169" CDS 1..>447 /gene="LOC104375169" /codon_start=1 /product="potassium-transporting ATPase alpha chain 1-like" /protein_id="XP_009979756.1" /db_xref="GeneID:104375169" /translation="
MVMVLTPPRPQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDAAKNAADMILLDDNFASIVTGVEQGRLIFDNLKKSIAYTLTKNIPELTPYLIYITASVPLPLGCITILFIELCTDIFPSVSLAYERAESDIMHLKPRNPRRDRLVN"
misc_feature <31..447 /gene="LOC104375169" /note="Haloacid Dehalogenase-like Hydrolases; Region: HAD_like; cl21460" /db_xref="CDD:451251" ORIGIN
atggtgatggtcctcaccccaccgcgcccccagggtgccatcgtggcggtgacgggcgacggggtgaacgactcgccggcgctgaagaaggccgacatcggggtggccatgggcatcgccggctccgacgccgccaagaacgcggccgacatgatcctcctggacgacaacttcgcctccatcgtcaccggcgtggagcaaggccgcttgatcttcgacaacctgaagaagtccatcgcctacacgttgaccaagaacatccccgagttgaccccgtacctcatctacatcacggccagcgtccccctgcccttgggctgcatcaccatcctcttcatcgagctctgcaccgacatcttcccctcggtctccttggcctacgagcgagcagagagtgacatcatgcacctgaaaccccgcaaccctcgacgcgaccgattggtcaac
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]