2024-05-19 17:22:30, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_009873738 746 bp mRNA linear VRT 24-OCT-2014 DEFINITION PREDICTED: Apaloderma vittatum ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1, 3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5 (ST6GALNAC5), mRNA. ACCESSION XM_009873738 VERSION XM_009873738.1 DBLINK BioProject: PRJNA263608 KEYWORDS RefSeq. SOURCE Apaloderma vittatum (bar-tailed trogon) ORGANISM Apaloderma vittatum Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Trogoniformes; Trogonidae; Apaloderma. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_009727668.1) annotated using gene prediction method: Gnomon, supported by mRNA and EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Apaloderma vittatum Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 6.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..746 /organism="Apaloderma vittatum" /mol_type="mRNA" /isolate="BGI_N311" /db_xref="taxon:57397" /chromosome="Unknown" /sex="male" /country="Tanzania" gene 1..746 /gene="ST6GALNAC5" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 1 EST, 6 Proteins" /db_xref="GeneID:104277173" CDS 6..746 /gene="ST6GALNAC5" /codon_start=1 /product="alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5" /protein_id="XP_009872040.1" /db_xref="GeneID:104277173" /translation="
MHCKSCALVTSSGHLLGSKQGDRIDETECVIRMNDAPTRGYGKDVGNKTSLRVIAHSSIQRILRNRNELLNMSHGAVFIFWGPSSYMRRDGKGLVYNNLQLMNQILPQLKVYMISRHKMLQFDDLFKRETGKDRKISNTWLSTGWFTMTIALELCDRINVYGMVPPDFCRDPNHLSVPYHYYEPLGPDECTMYISHERGRKGSHHRFITEKRVFENWARTFNIQFFQPDWKPEPLTVSHPEIKPVV"
misc_feature 9..554 /gene="ST6GALNAC5" /note="Glycosyltransferase family 29 (sialyltransferase); Region: Glyco_transf_29; pfam00777" /db_xref="CDD:425864" ORIGIN
taaaaatgcactgcaagagttgtgcgttggtaaccagctctggacaccttctgggaagtaaacaaggtgacagaatcgacgagacagagtgcgtaatacgaatgaatgatgcgcctactcgaggttacggaaaagatgttggaaacaaaacgagccttcgagtcatcgcacactccagtattcagaggattttgcgaaatcgcaacgaactcttaaatatgagccatggcgctgtgtttatcttctggggtcctagcagctacatgaggagagatggcaaaggcctggtgtataataacctgcagctgatgaatcagatactgcctcagttaaaagtatatatgatttctcgccacaagatgcttcagttcgatgacctttttaaacgggaaactggaaaagacaggaagatatccaacacttggcttagcacgggctggttcacaatgactatcgcattagagctctgtgacagaataaatgtttatggcatggtgccaccggatttctgcagggatcctaatcatctttcagtaccttatcattattatgaacctttgggacctgatgaatgcacaatgtacatttcacatgagcggggacggaagggcagtcaccaccgtttcatcacagagaaacgagtctttgagaactgggcacggacattcaatattcaattttttcaaccagactggaaaccagaaccactcactgtaagtcaccctgagattaaaccagtggtctga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]