2024-05-19 03:52:42, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_009843229 117 bp mRNA linear PLN 21-OCT-2014 DEFINITION Aphanomyces astaci hypothetical protein partial mRNA. ACCESSION XM_009843229 VERSION XM_009843229.1 DBLINK BioProject: PRJNA264335 BioSample: SAMN01906578 KEYWORDS RefSeq. SOURCE Aphanomyces astaci ORGANISM Aphanomyces astaci Eukaryota; Sar; Stramenopiles; Oomycota; Saprolegniales; Saprolegniaceae; Aphanomyces. REFERENCE 1 (bases 1 to 117) AUTHORS Russ,C., Tyler,B., van West,P., Dieguez-Uribeondo,J., Young,S.K., Zeng,Q., Gargeya,S., Fitzgerald,M., Abouelleil,A., Alvarado,L., Chapman,S.B., Gainer-Dewar,J., Goldberg,J., Griggs,A., Gujja,S., Hansen,M., Howarth,C., Imamovic,A., Ireland,A., Larimer,J., McCowan,C., Murphy,C., Pearson,M., Poon,T.W., Priest,M., Roberts,A., Saif,S., Shea,T., Sykes,S., Wortman,J., Nusbaum,C. and Birren,B. CONSRTM The Broad Institute Genomics Platform TITLE The Genome Sequence of Aphanomyces astaci APO3 JOURNAL Unpublished REFERENCE 2 (bases 1 to 117) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (21-OCT-2014) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 117) AUTHORS Russ,C., Tyler,B., van West,P., Dieguez-Uribeondo,J., Young,S.K., Zeng,Q., Gargeya,S., Fitzgerald,M., Abouelleil,A., Alvarado,L., Chapman,S.B., Gainer-Dewar,J., Goldberg,J., Griggs,A., Gujja,S., Hansen,M., Howarth,C., Imamovic,A., Ireland,A., Larimer,J., McCowan,C., Murphy,C., Pearson,M., Poon,T.W., Priest,M., Roberts,A., Saif,S., Shea,T., Sykes,S., Wortman,J., Nusbaum,C. and Birren,B. CONSRTM The Broad Institute Genomics Platform TITLE Direct Submission JOURNAL Submitted (02-DEC-2013) Broad Institute of MIT and Harvard, 7 Cambridge Center, Cambridge, MA 02142, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_009798330). COMPLETENESS: incomplete on the 3' end. FEATURES Location/Qualifiers source 1..117 /organism="Aphanomyces astaci" /mol_type="mRNA" /strain="APO3" /db_xref="taxon:112090" /chromosome="Unknown" /collection_date="2012" gene 1..>117 /locus_tag="H257_15209" /db_xref="GeneID:20817205" CDS 1..117 /locus_tag="H257_15209" /codon_start=1 /product="hypothetical protein" /protein_id="XP_009841531.1" /db_xref="GeneID:20817205" /translation="
MPWLTASSWPPSRALVLVRRTFPMRSWRNTTRSEHPLV"
ORIGIN
atgccctggctaaccgcatcttcatggcccccctcacgcgcactcgtgctggttcgacgcacgttcccaatgcgctcatggcggaatactacgcgcagcgagcatccgctggtctga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]