LOCUS       XM_009185580            1118 bp    mRNA    linear   PRI 20-NOV-2019
DEFINITION  PREDICTED: Papio anubis copper chaperone for superoxide dismutase
            (CCS), transcript variant X2, mRNA.
ACCESSION   XM_009185580
VERSION     XM_009185580.4
DBLINK      BioProject: PRJNA576697
KEYWORDS    RefSeq.
SOURCE      Papio anubis (olive baboon)
  ORGANISM  Papio anubis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_044987.1) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Nov 20, 2019 this sequence version replaced XM_009185580.3.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Papio anubis Annotation Release 104
            Annotation Version          :: 104
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1118
                     /organism="Papio anubis"
                     /mol_type="mRNA"
                     /isolate="15944"
                     /db_xref="taxon:9555"
                     /chromosome="12"
                     /sex="male"
                     /tissue_type="whole blood"
     gene            1..1118
                     /gene="CCS"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 128 ESTs, and 100% coverage of the
                     annotated genomic feature by RNAseq alignments, including
                     43 samples with support for all annotated introns"
                     /db_xref="GeneID:101024502"
     CDS             189..956
                     /gene="CCS"
                     /codon_start=1
                     /product="copper chaperone for superoxide dismutase
                     isoform X2"
                     /protein_id="XP_009183844.1"
                     /db_xref="GeneID:101024502"
                     /translation="

MTCQSCVDAVRKSLQGVAGVQDVEVHLENQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSDQLHNLGAAVAILGGPGTVQGVVRFLQLSPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGDHFNPDGASHGGPQDSDRHRGDLGNVHADADGCAIFRMEDEKLKVWDVIGRSLVIDEGEDDLGRGGHPLSKITGNSGQRLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL"

     misc_feature    189..890
                     /gene="CCS"
                     /note="copper, zinc superoxide dismutase; Region:
                     PLN02957"
                     /db_xref="CDD:215516"
ORIGIN      

ttaagggtgtctttcgagggtcagtccccgcgacgccgcgctgagtggtgctcctgcgcctgaagagttctgcgtttcgggctggtgactgggtccagaatggcttcggactcggggaaccaggggaccctctgcacgcgatcatcggtcggtccctgctgcccttgcagttggagttcgcggtgcagatgacctgtcagagctgtgtggacgcggtgcgcaagtccctgcaaggggtggcaggtgtccaggatgtggaggtgcacttggagaatcagatggtcttggtacacaccactctgcccagccaggaggtgcaggctctcctggaaggcacggggcggcaggcagtactcaagggcatgggcagcgaccagttgcataatctgggggcagcagtggccatcctgggagggcctggcaccgtgcagggggtggtgcgcttcctacagctgagccctgagcggtgcctcatcgagggaactattgacggcctggagcctgggctgcatggactccatgtccatcagtacggggacctcacaaacaactgcaacagctgtggggaccactttaaccctgatggagcatctcatgggggcccccaggactctgaccggcaccgcggagacctgggcaatgtccatgctgatgctgacggctgcgccatcttcagaatggaggatgagaagctgaaggtgtgggatgtgattggccgcagcctggttattgatgagggagaagatgacctaggccggggaggccatcccttatccaagatcacagggaactctgggcagaggttggcctgcggcatcattgcacgctctgctggcctcttccagaaccccaagcagatctgctcttgcgatggcctcaccatctgggaggagcgaggccggcccatcgctggcaagggccgaaaggagtcagcccagccccctgcccacctttgagcaggacctcaccttggctctgttgctgtcctccagggcgagcactttcctcttccagagggggccagagggaccttgcctgcccagtctttggagagctcagtacagggcaggagctgctgcggtgttcccttggcaaatgagttttattttcatttggga

//