LOCUS       XM_009142536             544 bp    mRNA    linear   PLN 07-DEC-2020
DEFINITION  PREDICTED: Brassica rapa protein CLAVATA 3 (LOC103864769), mRNA.
ACCESSION   XM_009142536
VERSION     XM_009142536.3
DBLINK      BioProject: PRJNA249065
KEYWORDS    RefSeq.
SOURCE      Brassica rapa (field mustard)
  ORGANISM  Brassica rapa
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Brassiceae; Brassica.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_024798.2) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Apr 3, 2020 this sequence version replaced XM_009142536.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Updated annotation
            Annotation Name             :: Brassica rapa Updated Annotation
                                           Release 103.20201202
            Annotation Version          :: 103.20201202
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.5
            Annotation Method           :: Best-placed RefSeq; propagated
                                           RefSeq model
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..544
                     /organism="Brassica rapa"
                     /mol_type="mRNA"
                     /cultivar="Chiifu-401-42"
                     /db_xref="taxon:3711"
                     /chromosome="A04"
                     /tissue_type="leaf"
                     /dev_stage="two weeks"
                     /country="China: Beijing"
     gene            1..544
                     /gene="LOC103864769"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 7 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:103864769"
     CDS             1..366
                     /gene="LOC103864769"
                     /codon_start=1
                     /product="protein CLAVATA 3"
                     /protein_id="XP_009140784.2"
                     /db_xref="GeneID:103864769"
                     /translation="

MIAPLLLSHYQSKEQLLSFIYSISLYKMDSRTLVLLLLFCLMFLHDASDITHANANVHALPIRKMMVMKKDNEWGGANGIEEEKEKVFGLNEELRTVPSGPDPLHHHVNPPRKPRTDSHIP"

ORIGIN      

atgattgccccccttctcctatctcattaccagagtaaagaacaacttctatcttttatatactctatctctctctacaaaatggattcgaggactctggtgctactgctgctcttttgcctcatgttcctgcatgatgcttctgatatcactcacgccaatgccaatgttcatgcacttcccattcgcaagatgatggtaatgaagaaggataatgaatggggaggagcaaatggaattgaagaagagaaggagaaggttttcgggttaaatgaagaactaaggactgtcccttcaggacctgaccctttgcaccatcatgtgaaccccccaagaaagccacgaaccgactctcatatcccttaaacctccttttttttctatgtatttcgtattataaattaactctgctgtttaatcggtttcatgttgagggattttctgttttatccctcactttccctaaggttgtgatgatagttaatgtaagataagcaccacttttgtttcccatggatctatttaggaaccccattttgatgta

//